Conserved Protein Domain Family
HTH_HspR-like_MBC

?
cd04767: HTH_HspR-like_MBC 
Helix-Turn-Helix DNA binding domain of putative HspR-like transcription regulators
Putative helix-turn-helix (HTH) transcription regulator HspR-like proteins. Unlike the characterized HspR, these proteins have a C-terminal domain with putative metal binding cysteines (MBC). Heat shock protein regulators (HspR) have been shown to regulate expression of specific regulons in response to high temperature or high osmolarity in Streptomyces and Helicobacter, respectively. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.
Statistics
?
PSSM-Id: 133395
View PSSM: cd04767
Aligned: 4 rows
Threshold Bit Score: 187.703
Threshold Setting Gi: 116747808
Created: 26-Jan-2007
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:DNA binding residues [nucleic acid binding site]
Evidence:
  • Comment:Based on sequence similarity to BmrR and the structure of Bacillus subtilis BmrR bound to DNA (1EXI).

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1          ###             #              ###                                            
gi 83590294    6 LYPISVVAELLGIQPGTLRVWERHKLIQPARKNGRRLYSNNDLKRLRFIKRLID-KGFNLNSLKHYLAFYPCWLL--EDC 82
gi 89895810   18 LYSIGTVAELIEEHPETLRVWERNGLIHPNRDKYQRKYSNNDLLRLKFIKYLMNeKGLNIAGVKQITSMYSCWYNrnCKG 97
gi 116747808   9 LYPIGIVAELLNIHPRTLRIYEQEGLIKPARRGGKRFYSNIDLQWLRCLRKLLTdEGLNIAGIKKLLTIAPCWSIrdCDE 88
gi 88944767    9 MFNIGVIAELLKVHPETLRIWEKHGLVEPSRRNKQRLYSNNDVKRLQFIHFLINeKGLNIAGVLQIISMYPCWSTk-HCA 87
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|
Feature 1                                                
gi 83590294   83 PSCSHKTERIGCAKPCWKEegTYCLIsfEDPSLCSKCPYK 122
gi 89895810   98 GGMRSSTIPINESKPCWKIegTYCFIasDKSELCSTCEML 137
gi 116747808  89 ETRKQCPAILNFPVPCWELk-PRCCK--DSDLACSDCEVY 125
gi 88944767   88 GGNQSKDEKVNINKPCWKEqgTYCYVieDKADQCSACPHY 127

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap