Conserved Protein Domain Family
HTH_MerR2

?
cd04769: HTH_MerR2 
Helix-Turn-Helix DNA binding domain of MerR2-like transcription regulators
Helix-turn-helix (HTH) transcription regulator MerR2 and related proteins. MerR2 in Bacillus cereus RC607 regulates resistance to organomercurials. The MerR family transcription regulators have been shown to mediate responses to stress including exposure to heavy metals, drugs, or oxygen radicals in eubacterial and some archaeal species. They regulate transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Statistics
?
PSSM-Id: 133397
View PSSM: cd04769
Aligned: 10 rows
Threshold Bit Score: 150.979
Threshold Setting Gi: 113968430
Created: 8-Dec-2006
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
DNA bindingputative dimer
Feature 1:DNA binding residues [nucleic acid binding site]
Evidence:
  • Comment:Based on sequence similarity to BmrR and the structure of Bacillus subtilis BmrR bound to DNA (1EXI).

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         ###             #                 ###                                          
gi 4588029     4 LTIGQLAQQTGVSRKAIRLYEEKELILpSIKRSEgNYRVYNqEHVFCINGIKQLRSLGVSLEEMKDLIVIFeknt-veie 82
gi 6177992     4 LTIGQLAQQTGVSRKAIRLYEEKELILpSIKRTGgNYRVYNqEHVFCINGIKQLRSLGVSLEEMKDLIVIFeknt-veie 82
gi 7578779     9 MTIGELSHRTGVPIKTLREYTDTGLIY-TVGRSPaNYRLYDaDALWCVHWIGELRGLGLTVAEIRASTREClgradrsvg 87
gi 71365130   11 MTVGELSRRTGVPAKNLRAYTDAGLVY-SVGRTGaNYRLYDaEALWCVAAITELRQLGLTLAEIREFGAGYlaregepig 89
gi 113968430   1 MYIGAVAKQTGLSIKAIRLYEEWGLIS-APIRKG-RYRTYSaTDIKQLMLIKEAKTLGIKLSQLKDLFTEGeqa---aql 75
gi 26989507    1 MYIGKAAQLSGTTVKSIRHYEEIGLLP-PPQREG-KYRIYSqQSVELLTFIKCAQQLGFKLKEMQAILQDHrgqe--lpw 76
gi 68545526    7 MYIGEAARVTGLTIKAIRFYEQKGLLP-SPQRDG-RYRVYSpQHLELLRLIRDAKALGVPLTKLMAVVPAKgdt---ldw 81
gi 70734261    1 MYIGQAAQLSGTTVKSIRHYEAIGLLP-EAPRQG-RYRLYDaQSVEQLIFIKCAQQLGFKLKELQQVFATHqgqa--fpw 76
gi 77456941    1 MYIGQAAQRSGTTIKTIRHYESIGLLP-EAPRQG-KYRVYDpQTVELLSFIKCAQALGFRLRELQAIFAGQpel---tpy 75
gi 88798334    1 MYIGEFCKQTQTTPKTIRYYESLGLLP-PAKRLG-SYRVYDdTYVETVRRIKQAQSYGFTLTELKKIFTGVdirr-glpa 77
                         90       100       110
                 ....*....|....*....|....*....|....*....
Feature 1                                               
gi 4588029    83 PHLQHLLKDKLTKIDEQINELQKLRKHIESYLDSPKEAF 121
gi 6177992    83 PHLQHLLKDKLTKIDEQINELQKLRKHIESYLDSPKEAF 121
gi 7578779    88 PHLAELLHRSRERARWRITEQQQILARIDAFEADHRADL 126
gi 71365130   90 PRLAQMLERSRARVEQQIAELEEVRRRIDDFVAANRDRL 128
gi 113968430  76 ESVQQFLLNIKADFQRQISELEDKLVRLDACIDGLDTCE 114
gi 26989507   77 DLAMQAIDNKKQELMGQIQALQQVHDGLVEFELSLKDAQ 115
gi 68545526   82 QQIRRFLEGIKQDIRAQQLRLEQQLATVDECLSAIDDCP 120
gi 70734261   77 DRAQAALAQKKRELQQQIEDLQQLQGRLELFETSLQQAR 115
gi 77456941   76 EKARRAIADKQQEIAAQLLKLTRQQEELSALEASLEHAQ 114
gi 88798334   78 DVMRRAIQEKRRAIAAQITELQQTDAALVDLEGFLKQSG 116

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap