Conserved Protein Domain Family
PTKc_PDGFR_beta

?
cd05107: PTKc_PDGFR_beta 
Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta
PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR beta is a receptor PTK (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR beta forms homodimers or heterodimers with PDGFR alpha, depending on the nature of the PDGF ligand. PDGF-BB and PDGF-DD induce PDGFR beta homodimerization. PDGFR signaling plays many roles in normal embryonic development and adult physiology. PDGFR beta signaling leads to a variety of cellular effects including the stimulation of cell growth and chemotaxis, as well as the inhibition of apoptosis and GAP junctional communication. It is critical in normal angiogenesis as it is involved in the recruitment of pericytes and smooth muscle cells essential for vessel stability. Aberrant PDGFR beta expression is associated with some human cancers. The continuously-active fusion proteins of PDGFR beta with COL1A1 and TEL are associated with dermatofibrosarcoma protuberans (DFSP) and a subset of chronic myelomonocytic leukemia (CMML), respectively. The PDGFR beta subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 133238
View PSSM: cd05107
Aligned: 3 rows
Threshold Bit Score: 885.122
Threshold Setting Gi: 82071582
Created: 10-Jul-2007
Updated: 2-Mar-2014
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:includes ATP binding and substrate binding sites
  • Comment:Based on the structures of other PTK family members bound to substrate peptides and ATP analogs, as well as the structure of human c-Kit bound to MgADP.
  • Citation:PMID 9312016

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                     ## #### #                 # #       
gi 82071582   558 YEIRWKVIESVSQDGHEYIYVDPIHLPYDLAWEMPRDNLVLGRTLGSGAFGRVVEATAHGLSHSQSSIKVAVKMLKATAR 637
gi 118097470  558 YEIRWKVIESVSSDGHEYIYVDPMQLPYDSSWEVPRDKLVLGRTLGSGAFGRVVEATAHGLSHSQSTMKVAVKMLKSTAR 637
gi 119582150  563 YEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQLVLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTAR 642
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                 # #   #                                 
gi 82071582   638 RSETQALMSELKIMSHLGPHLNIVNLLAACTKHGPLYLVTEYCRYGDLVDYLHRNKHTFLQYYLDKNQddg-slISGGST 716
gi 118097470  638 SSEKQALMSELKIMSHLGPHLNIVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQSYGEKARre--aeLYGNTI 715
gi 119582150  643 SSEKQALMSELKIMSHLGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRppsaelYSNALP 722
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 82071582   717 PLSQRKGYVSFgSESDGGYMDMSKDEPavYVPMQEQMDTIKYADIQPSPYESPY--QQDLYQEQGGGrvdLVISDSPALT 794
gi 118097470  716 KEDHVQSHLSLsVESDGGYMDMSKDESldYVPMSDMKGEVKYADIESSNYGTPYelDSYSPSAPERTdrvTLINESPLLS 795
gi 119582150  723 VGLPLPSHVSLtGESDGGYMDMSKDESvdYVPMLDMKGDVKYADIESSNYMAPY--DNYVPSAPERTcraTLINESPVLS 800
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                   #   ## #          #                 #####        #    
gi 82071582   795 YDDLLGFSYQVAKGMEFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMHDSNYISKGSTFLPLKWMAPESIFHnL 874
gi 118097470  796 YMDLVGFSFQVANGMEFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNnL 875
gi 119582150  801 YMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNsL 880
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                       #                                                 
gi 82071582   875 YTTLSDVWSYGILLWEIFTLGGTPYPDLPMNELFYSPLKRGYRMAKPAHASDEVYEIMKRCWDETFEKRPDFSFLVHCVG 954
gi 118097470  876 YTTLSDVWSFGILLWEIFTLGGTPYPELPMNEQFYNAIKRGYRMSKPTHASDEIYDIMQKCWEEKFEIRPSFSQLVVLMG 955
gi 119582150  881 YTTLSDVWSFGILLWEIFTLGGTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLE 960

                  ....
Feature 1             
gi 82071582   955 DMLT 958
gi 118097470  956 NLLV 959
gi 119582150  961 RLLG 964

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap