Conserved Protein Domain Family
PTKc_Srm_Brk

?
cd05148: PTKc_Srm_Brk 
Catalytic domain of the Protein Tyrosine Kinases, Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites (Srm) and Breast tumor kinase (Brk)
PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Srm and Brk (also called protein tyrosine kinase 6) are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) PTKs. Brk has been found to be overexpressed in a majority of breast tumors. Src kinases in general contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr; they are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Srm and Brk however, lack the N-terminal myristylation sites. Src proteins are involved in signaling pathways that regulate cytokine and growth factor responses, cytoskeleton dynamics, cell proliferation, survival, and differentiation. The Srm/Brk subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 133248
View PSSM: cd05148
Aligned: 6 rows
Threshold Bit Score: 474.616
Threshold Setting Gi: 47211704
Created: 4-Aug-2007
Updated: 2-Mar-2014
Structure
?
Aligned Rows:
  next features
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                      # ###   #            # #                                           
gi 18250298   223 WERPHSEFALGRKLGEGYFGEVWEGLWLg-SLPVAIKVIKSANm-kLTDLAKEIQTLKGLRHERLIRLHAVCSggEPVYI 300
gi 118100717  223 WERPRWEFTLRRKLGEGYFGEVWEGLWRn-TVPVAIKIIKADMk--AEDFTKEIQNLKRLRHEKLIQLHAVCSldEPVYI 299
gi 47211704   233 WERPREEFRLLRKLGEGHFGEVWEALWSteNRRVAIKTLKQEDt-kQDEFVKEVQALKSLHHPKLIQLLAMCSrgEPVYI 311
gi 8928302    184 WERPREEFTLCRKLGSGYFGEVFEGLWKd-RVQVAIKVISRDNllhQQMLQSEIQAMKKLRHKHILALYAVVSvgDPVYI 262
gi 47211705   824 WELPKKEFELEEELGSGCFARVYRGRWKn-LIRVAVKILKSDSelnHGDFQTEVQILKNLRHRHLLSLFAVCTesRPYWI 902
gi 115496864  241 WELPKEEFQLENQLGSGHFADVYSGKWKn-HSKVAIKILKNNDalvLREFQLEVQIMKRLRHKHLISLFAVCTssSPFYI 319
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1          ####   #                                        #   ## #          #            
gi 18250298   301 VTELMRKGNLQAFLGTPEGRALRLPPLLGFACQVAEGMSYLEEQRVVHRDLAARNVLVDDGLACKVADFGLARLLKDDIY 380
gi 118100717  300 ITELMRKGNLHSYLNSPEGKSLGTSHLLNIACQVADGMRYLEEKHIVHRDLAARNILVGEELTCKIADFGLARLLKDDIY 379
gi 47211704   312 VTELMTKGSLKAYLASAEGQVLTSAHLIYMGSQIAEGMAYLEDRNIVHRDLAARNILVGEDLVCKVADFGLARIIKDSVY 391
gi 8928302    263 ITELMAKGSLLELLRDSDEKVLPVSELLDIAWQVAEGMCYLESQNYIHRDLAARNILVGENTLCKVGDFGLARLIKEDVY 342
gi 47211705   903 ITELMEKGSLLIFLRSPEGQNQDVASLIDMGTQVADGMSYLEEQKSIHRDLAARNVLVGEDYTCKVGDFGLARVIKEPFY 982
gi 115496864  320 ITELIEKGDLLHFLRNPEGRSLQMESLIDMAAQVADGMAYLEANNSIHRDLAARNVLVGDGYVCKIADFGLARIIKEPVY 399
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1             #####        #                                                              
gi 18250298   381 SPSsSSKIPVKWTAPEAANYRVFSQKSDVWSFGVLLHEVFTYGQCPYEGMT----------------------------- 431
gi 118100717  380 STSsSTKIPVKWTAPEAANYRTYSLKSDVWSYGILLYEVFTYGQIPYEGMT----------------------------- 430
gi 47211704   392 TASrNTKIPVRWTAPEAAIHQRFSVKSDVWSFGVLLYEMMSRGKMPYEGRNqpgagwnsrp------------hapflsa 459
gi 8928302    343 LSH-DHNIPYKWTAPEALSRGHYSTKSDVWSFGILLHEMFSRGQVPYPGMS----------------------------- 392
gi 47211705   983 ITE-DKKIPYKWTAPEAISHGKFSNKSDVWSFGILLYEITTYGGVPYPGALfsrswshdqrpgsvlrvdaqcvspvssst 1061
gi 115496864  400 LSD-DKKIPYKWTAPEAIGHGTYSSKSDVWSFGILLYEIVTHGGIPYPGVN----------------------------- 449
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*.
Feature 1            #                                                    
gi 18250298   432 ---NHETLQQIM-RGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKLHAI 483
gi 118100717  431 ---NQETIRQIT-RGYRLPRPSSCPPEIYSIMLECWSGNTEERPTFLALREKLGFI 482
gi 47211704   460 gknNKEVLDLLA-SGFRLPCPTRCPQNIYRMMMGCWAAEPSKRPSFHALHSQLDAI 514
gi 8928302    393 ---NHEAFLRVD-AGYRMPCPLECPPSVHKLMLTCWCRDPEQRPCFKALRERLSSF 444
gi 47211705  1062 amsVQEAYQQVT-AGYRMPAPAKCPHFLYQIMLKCWAAEPDDRPDFRTLKVELDNS 1116
gi 115496864  450 ---TGEVYDLITkENYRMPSPPKCPQAIYNIMRACWRIESVDRPNFKVLKDELDNY 502

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap