Conserved Protein Domain Family
MDH_like

?
cd05295: MDH_like 
Malate dehydrogenase-like
These MDH-like proteins are related to other groups in the MDH family but do not have conserved substrate and cofactor binding residues. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subgroup are uncharacterized MDH-like proteins from animals. They are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Statistics
?
PSSM-Id: 133431
View PSSM: cd05295
Aligned: 8 rows
Threshold Bit Score: 724.167
Threshold Setting Gi: 196013416
Created: 22-Dec-2005
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:putative NAD binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 56971399    9 RADCPYYAKTELVADYLQKNLPDFRIHKITQRPEVWEDWLKDVCEKNKWSHKNSPIIWRELLDRGGKGLLLGGYNEFLEH 88
gi 20302744    9 QADCPYYAKVELLADSLQSKLQDFHVHKIVKTPEEWKPWLQQLCADNGWTHGRSPIIWRELVDRGGKGLLIGGHNDFMEY 88
gi 50750308    9 RAGCPEYARAELLADYLQANLPAFRVHKVVQHPDRWEQWLHDVCEMNGWEHEWSPIIWRELLDRGGKGLLLGGLNEFLEY 88
gi 126338001 143 KADCPYFAKAELLADYLQKNLPDFQIHKIIQHPDIWEQWLQDICKKNQWSHKRSPIIWRELLDRGGKGILLGGFNEFMEH 222
gi 156225019   9 RSDCPFYAKAELLADELSLNLPDFKVHKIVKRPDEWDDWMNKMCDDNGWKHSGSPLIWRELVDRGGKGILLGGCDDFLEF 88
gi 149632984   1 RADCPFFAKAEILADYLQKNLPNFRIHKIKQHPDLWERWLKDLCTKNRWSHKLSPIIWRELLDRGGKGQLLGGLNEFLEY 80
gi 196013416   9 RSNCPFYAKAELLADELAMNLPNFKVHKISKHPSEWEAWLRQTCLGMGFEHDTSPIVWRELVERGGAGKLIGDCNDFLEY 88
gi 115666539   3 RANCPYYAKVELLADELDATLQDFSVHKIVKQPAEWEDWLQQQCKQNNWSFKKSPIVWRELLDRGGAGVLIGGSNEFQEY 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                         # ####                         
gi 56971399   89 AQLYYDVTSSMTTELMmvIAQENLGAHIekEQEEEALKTCINPLQVWITSASAPACYNLIPILTSGEVFGMhTEISITLF 168
gi 20302744   89 ARSYYGMTSGMLSEMMknIAAENLAVTQelREEEETIRRQSKPLHVCVINAARSPAYHVLPSLVNGKILRE-EEIALHLH 167
gi 50750308   89 AQHYYGITSMMLTEEMldIAEENLQAHVesEKEQEEIRSLINPLQIWITSASAPTCYQLIPLLASGDVFGMtTEISIHLL 168
gi 126338001 223 IELYYGITSKMMTDDMllIADENMETHIeiEQEEKELKEMINPLQVWITGASCPTCYHLIPILASGEVFGLeEEISINLL 302
gi 156225019  89 AEGYYGLASRLKSAKLvsISEENKSTKIevDKEEEELAKKINPLRVCVSKASGPLAYGMLASLVQGEVFGFqEEVSIYLL 168
gi 149632984  81 SQLYYGISSDMTSEEMqlIAEENLQSHIevELEREERESLINPLQVWICRASALACYILIPILASGEVFGMeTEISIHLL 160
gi 196013416  89 VESYYHFSSSMMSEELtvVADENMETLA--KDLAEAKIVKSWPLRVCITNASSSLVYNIVLSLANGDAFGKnEELDLRLV 166
gi 115666539  83 AYSYYGVSSEQMSSDMtkIASENLETKIimDAEEQHRLSRSTPLQVCITNSSSPIAYHMVNEIARGDVLGHdNEVSIRLL 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        ##                                           ###                                
gi 56971399  169 DNKQAEEHLKSLVVETQDLASPVLRSVSICTKVEEAFRQAHVIVVLDDSTNKEVF---TLEDCLRSRVPLCRLYGYLIEK 245
gi 20302744  168 DSEENLEKLKGLEMEVFDLSFPFLKEISVTTDLPTAFQNAHIAIVLDDFDQGGKE---DAIGDMETKVSFYKRVAEAINQ 244
gi 50750308  169 DAVQFKECLSGIVMEAEDMAFPLLRSISAHTEVDKAFLQADVIIVLDDILLKRGTl--TLENCIRTVSEICQVYAPLIEK 246
gi 126338001 303 SSTYNEDNLRGLVMESEDLALPLLRNISLCTEINEAFLEAHVIVILNDIIEDESE---PLEDRIRDRFPICQLYGSLIDK 379
gi 156225019 169 DTPENQEALQGVAYEIEDCAWPLFRGVHITSDPAVAFKDASVVVLLDGKAINEGT---DKKEYLLSHAKLFRDYGKALEA 245
gi 149632984 161 DSHRYRRILEGLVIAAQDLAAPLLRNISKHTDFERAFFEADVIVLLDDTLEKEVL---SLEHCLRGEMMKCRRYGSLIEK 237
gi 196013416 167 DSGENLEKLHGLVMELEDLAGPLLRKITATGQLDVGVKDAQVVILTDGSSIPIDAsdeDKQTIINANRAIYQDYGPVIEE 246
gi 115666539 163 TKPEDKDYVEGQCMEVFDLACPLLRGVKVYTDATAALTGVHVAVFLDEFCLMEEEn-aKLGGVSQEGCAQFALYGRILNQ 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                  # ##                        #                               #         
gi 56971399  246 NAHeSVRVIVGGRTFVNLKTVLLMRYAPRI--AHNIIAVALGVEGEAKAILARKLKTAPSYIKDVIIWGNISGNNYVDLR 323
gi 20302744  245 TASkDIRVLVAGTGPLNSLVSILIDHTPSIp-RQNIAAVAQVKERQAKSLLAKRLTVNSAGVCDVIVWGNVGGTTYTDVS 323
gi 50750308  247 NAKsGVRIISTGKTFVNLKAMMIITYGPSIk-PENVIAVATSWESAAKAMLARKLNMNTAGVKDVIVWGNVTGCTYIDLS 325
gi 126338001 380 NANeNVKVIVAGKTFLNLTTSLIIQHTPSVn-PRNIIAVAMIVENEAKAMLARKLKTLPSYVKDVIIWGNITGFRYIDLK 458
gi 156225019 246 HAK-PDCKVLTAGGPANFSTFIASKFAPSIq-KKNFVSLSRIEENRAKGLIAKRLNVNTAGIKDLIVWGNPGFNHYPDAS 323
gi 149632984 238 NANrEVKVIVAGRTFVNLKTLSIVKYAPSIr-QENVIAVAMLLENKAKALLARKLRIASSGIKDVIVWGNITGSNYIDLR 316
gi 196013416 247 GID-KDGIIFIGGEAANYQASVLSKYAPKVpkRKFIALSSRLQENRAKSVLSNRLKVNSSKINNVIVWGNPQINQVIDVS 325
gi 115666539 242 YAEqDVKVLIGGRGKLNFSALMLKHNAPRIa-RQNIIITPRLQENRAKAAIARKINVNTAGVADLIIWGNIGGITHFDIS 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 56971399  324 KTRVYRYESAIWGPLHYSR--PVLNLIFDSEWVKREFVAILKNLtt----tgRQFGGILAAHSIATTLKYWYHGSPPgEI 397
gi 20302744  324 RARVHGYDGAIWGPPSYSC--SVSEMVHDNKWLEGEFLEQLQSRshtiqdslQHSADLSMAAAISSTLSYWWNGSPEgQL 401
gi 50750308  326 HAKLYRCDSAIWGPANFSR--PLLNLIYDSKWINSEFISAQSSLrs----rvCHCAGMLPAHAVATALRYWFHGSPPgEI 399
gi 126338001 459 KAKIFKYNSAIWGPPNYSR--FLLQLIFDSEWIRKEFVASLNAWsl----keHFQKAIPSAHCIATMLTFWFHDSPPgEF 532
gi 156225019 324 HARVDGFDGAIWGPHVPGFtrPVPEMVHDNKWLSGEFVEVLKKPs-------EGENALMGSVAVKSLLQDWCQCASS-DM 395
gi 149632984 317 KAKLYRYDSAIWGPPNYSR--PLLGMIYDSEWINKEFIAELNVLns----sqNRSQAISPAHSIATTLKYWYQDSPPgEI 390
gi 196013416 326 KSHVYDCDSAIMGPADYSR--SVVELVHDNKWINGTFQATVKDRheeitklrPGETSISIANSIIEQLSDFWHGKNDdII 403
gi 115666539 321 QARVYKYEGAIWGPSSFSR--PVTEVVHDEKWLQTEYPQLLQNHpdalatmlNHKVAMSEAHALTSILTHWYNGSPDkEI 398
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
Feature 1                                                                       
gi 56971399  398 VSLGILSEGQFGIPKGIVFSMPVKFENGT-WVVLTDLKDVEISEQIMTRMTSDLIQEKLVALG 459
gi 20302744  402 FSLAVCSEGFYNIPEGVVFSFPVMFHKGS-WEVVQDIDMNEDMRVMLSSITAQLVEEKDLLLH 463
gi 50750308  400 VSMGVLSEGQFCIPEGIIFSMPVRFQNGS-WEVVTELEINEKTQEVLECLSYDLIQEKRVALK 461
gi 126338001 533 FSVGIRSEGEFGMPEGMVISMPAQCQNGI-WTVPTDLIESELTEDVRNRIIHDLQQEQLVASG 594
gi 156225019 396 WSLGVISEGWYDIPEGIAFSFPVKFTGGS-WQVVEGLALSDSLKEVLKNIAQEAKAETEEVLA 457
gi 149632984 391 VSLGVMSDGQFGVPEGIVFSMPVKFQNGK-WVVLTDLEDVEINEETMKVLVSDLIQEKLVAFG 452
gi 196013416 404 TSMSIISEGWYGIPYGIAFSFPVQLKARGeLQVVTDWGLDETLRGKLVAIGRELFKVLNASSE 466
gi 115666539 399 FSLGVYSDGWYDLPVDIFFSLPVKFQKGA-WEVVQDRQVTTEIRAQLDQITNELIHERYVIFP 460

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap