1S6Y,1UP7,1UP4


Conserved Protein Domain Family
GH4_P_beta_glucosidase

?
cd05296: GH4_P_beta_glucosidase 
Click on image for an interactive view with Cn3D
Glycoside Hydrolases Family 4; Phospho-beta-glucosidase.
Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Statistics
?
PSSM-Id: 133432
View PSSM: cd05296
Aligned: 44 rows
Threshold Bit Score: 504.372
Threshold Setting Gi: 163840447
Created: 6-Dec-2005
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 16 residues -Click on image for an interactive view with Cn3D
Feature 1:NAD binding site [chemical binding site]
Evidence:
  • Structure:1UP7_A: Thermotoga maritima 6-Phospho-Beta Glucosidase binds NAD, contacts determined at 3.5A
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                ## #                       ##         #                                 
1S6Y_A         8 LKIATIGGGSSYTPELVEGLIKRYHELPVGELWLVDIPe----gKEKLEIVGALAKRXVEKAgv-----piEIHLTLDRR 78
1UP7_A         3 MRIAVIGGGSSYTPELVKGLLDISEDVRIDEVIFYDID------EEKQKIVVDFVKRLVKDRf--------KVLISDTFE 68
gi 29828296    1 MKLTILGGGGFRVPLVYGALLGDRAEGRVTRVVLHDLD------AGRLTAVARVLAEQAAGDpd-----apEVSFTTDLD 69
gi 148271527   1 MRLTILGGGGFRVPLVYSALLRDHEAGRVDHVALYDTD------EVRLTAVARVLAEQAAAYad-----apVITLHTDLD 69
gi 15141176    1 MKLTLIGGGGVRAPLFVGSALRRAERSGLSEICLQDIN------ERKLELFGRISQELARRTqs-----pvRITMAADAE 69
gi 154507906   4 MQLTIVGGGGFRVPAMIDVLARSRSGQGAYASLDVDRVilydtdARRLDAMMAVLSSLDFPHs-------pTVRATTDIN 76
gi 119960495   1 MRLMIAGGGGFRVPLVYRALCAGPFAGLVDELVLFDVD------GSRLAAMEAVLRDMPADEgs-----apAVVVSTDLG 69
gi 50839154    1 MKLTILGGGGFRVPLVFKALAHDTSPQRVTELRLYDTD------PLRLGVIETVVAQLARALph-----apSVVATTDLP 69
gi 72163167    1 MRLTILGGGGFRVPLIHRALLADARHPDPPITELVLFDt----aPERVAVIRTILEQQREAHravygepplTVRVADTLD 76
gi 163840447   1 MRLVIIGGGGFRVPLVYRALSAGKYAGLIDSVALYDVD------ASRLAAIQAVLAAAPFSGp--------VVMASTSLP 66
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                   ###                      #                   #               # #     
1S6Y_A        79 RALDGADFVTTQFRVGGLEARAKDERIPLKYGVIGQETNGPGGLFKGLRTIPVILDIIRDXEELCpDAWLINFTNPAGXV 158
1UP7_A        69 GAVVDAKYVIFQFRPGGLKGRENDEGIPLKYGLIGQETTGVGGFSAALRAFPIVEEYVDTVRKTS-NATIVNFTNPSGHI 147
gi 29828296   70 EALRGADFVFSAIRVGGLEGRADDERVALAEGVLGQETVGAGGIAYGLRTVPVAVDIARRVARLApDAWVINFTNPAGLV 149
gi 148271527  70 EALAGAAFVFSAIRVGGMAGRSCDERLGMAHGVIGQETVGYGGISYALRTLPVVMDLAERIRVQApDAWVINFTNPAGVV 149
gi 15141176   70 RALDGARYVVTTVRPGNEDGRIKDERIALAHGVLGQETTGPGGFAMALRSIPVILKYAEILKKVSpDAWLFNFTNPAGLV 149
gi 154507906  77 EALPGADFVFSAMRVGGTCGRVLDEHCGLDHGLLGQETVGVGGYCYAFRSLGPALELARAAKRLCpGAWLINFTNPAGII 156
gi 119960495  70 QALTGTDMVFAAIRPGGTAGRITDEQIPLGLGLLGQETTGAGGISYALRSIPHMLELAAAMRRHCpDAWLINFTNPAGMV 149
gi 50839154   70 TALAGTDFIFSAIRVAGTHGRALDESMCLARGVIGQETVGAGGISYALRGIPVVLDLVEQITRYApDAKVINFTNPAGVM 149
gi 72163167   77 EALRGSAIVFSAVRVGGAEGRVRDERVALAAGVLGQETVGAGGISYGLRTVPVAVAIAQHVARLApQAWVINFTNPAGLI 156
gi 163840447  67 QALEGADIVFSATRVGGPEGRVLDERVALDLGVLGQETTGAGGISYAFRSIPFMVQLAQERRNHCpAAWLINFTNPAGMV 146
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1S6Y_A       159 TEAVLRYtkQEKVVGLCNVPIGXRXGVAKLLgv-------------daDRVHIDFAGLNHXVFGLHVYLDGVEVTEKVID 225
1UP7_A       148 TEFVRNYleYEKFIGLCNVPINFIREIAEMFsa-------------rlEDVFLKYYGLNHLSFIEKVFVKGEDVTEKVFE 214
gi 29828296  150 TEAMSRHl-GDRVIGICDSPVGLGRRIARVLga-------------dpREAFIDYVGLNHLGWVRGLRVAGRDELPRLLA 215
gi 148271527 150 TEAMSRVl-GDRVIGICDSPIGLARRVLGALgv-------------qgDDVVIDYAGLNHLGWLRGLRVDGRDVLPDLMA 215
gi 15141176  150 TQALQNEg-YHRTVGICDGANGAQEALAHWHkv-------------qqNDVRCEVYGLNHLSFTRRATIDGKEVLQPLLD 215
gi 154507906 157 TQAMRSVl-GERVVGICDTPIGLVNRTLNALgvad----------eerTDVSFDYVGLNHLGWLRSLSVDGRDILPRLFA 225
gi 119960495 150 TEALVPIl-GRRVIGICDSAGGLVQRAARAAgapl----------negTLDGVGYYGLNHLGWLYRLAPAGRDLLPGLLS 218
gi 50839154  150 TEVMQRRl-GDQVVGICDSPVGLARRILTTLqraglapadlgslfdgdGRIHIGYSGLNHLGWLTSLNVDGVDVLPRLLE 228
gi 72163167  157 TEAMTQIl-GDRIIGICDSPVGLGRRAARALgl-------------dpARVHFDYAGLNHLGWLRGLHADGRNRLPDLLA 222
gi 163840447 147 TQALVPLl-GAKVIGICDSPLGLVRRAAKTAgip------------lsGMNGVDYLGLNHLGWLNGLVHDGVDQLPGLLS 213
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                           #            
1S6Y_A       226 LVAHPDrsgvtxknivdlgWEPDFLKGLKVLPCPYHRYYFQTDKXLAEELEAakt-kgTRAEVVQQLEKELFELYKDpnl 304
1UP7_A       215 NLKLKLsnip------dedFPTWFYDSVRLIVNPYLRYYLMEKKMFKKISTHe-----LRAREVMKIEKELFEKYRTav- 282
gi 29828296  216 DPGLLGsfee------gklFGPDWLRSLGAIPNEYLHYYYFNREAVRAYSEAe----kTRGAFLRDQQARFYEEMKRads 285
gi 148271527 216 RPDLIGtfee------grlFGAEWVTELGAVPNEYLHYYYFRREVRHADQLAa----qTRGAFLVEQQGRFYEQLEHrhd 285
gi 15141176  216 DDGFLRsts-------qrmFDASLIRSQRNWINEYLYYYYYAEKAVEALKADa----rTRGEEVKDLNAALITRLSAmdl 284
gi 154507906 226 DEAALGsmee------sraIGTDWIRALGALPNEYLFYYYCHREAMARIHQDq-----TRGEYLRDQQEAFYNAVLAdpe 294
gi 119960495 219 DRVALEtmee------grlFGQHTLEKLGCLPNEYLYYYYQTAQATEAIGQQs----eTRGTSIHQQQNSLYPSLLQdph 288
gi 50839154  229 RPDLIEsfee------grlFGADLVQALGAVPNEYLHYYYYSRDDLAADRKAe----aPRGAFLEAQQNQFYTQAQHtdd 298
gi 72163167  223 DEAALTsfee------grlFGAAWLRALGALPNEYLHYYYLARETREEIARTlaagghTRGEQLVVQQKEFYRLAAArpr 296
gi 163840447 214 SPARLAefee------grlFGADFLAALVSLPNEYLFYYYRRQSALQAIMAAa----qTRGASIALAQQMSYPQFTGaka 283
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                       #                                      #                         
1S6Y_A       305 ------aikPPQLEKR----------------------------------GGAYYSDAACSLISSIYN----------DK 334
1UP7_A       283 -------eiPEELTKR----------------------------------GGSMYSTAAAHLIRDLET----------DE 311
gi 29828296  286 sa---lsawDRTRAEReatymaenrda-------------agagerdaddLSGGYEKVALALMRAIAR----------DE 339
gi 148271527 286 vs--alalwERTRLDRettymatnrqs------------agmgdrdeddlVSGGYEDVAIALMRGIAY----------DQ 341
gi 15141176  285 nadaerrspPNYAYERrrnatymhyaltdapsmeeadrlveglaaaqtgeEGEGYAGVALNLVDALET----------GK 354
gi 154507906 295 qa---gqtwIDALADReatymaeardv------------dersgrraediAGGGYQKVALDLMKALATnt------paRM 353
gi 119960495 289 p----yrlwDAARRSReegylaeart--------------hgeqrdesdlAGGGYERVALSVMRALSGggtaqlilnvPN 350
gi 50839154  299 v----aglwEATRLEReetymatnrev------------sgeferdeadlETGGYDKVALAIMHAIAN----------DV 352
gi 72163167  297 da---ydlwEQTRREReetymadnrra------------aggverdeadlDGGGYEQVALAVMRAILR----------DE 351
gi 163840447 284 f-----erwDAARLEReagylaesr----------------dsardeadlAGGGYDEVALAAMNTLLT----------GQ 332
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1S6Y_A       335 RDIQPVNTRNNGAIASISAESAVEVNCVITKDGPKPIAVGD-LPVAVRGLVQQIKSFERVAAEAAVTGDYQTALVAXTIN 413
1UP7_A       312 GKIHIVNTRNNGSIENLPDDYVLEIPCYVRSGRVHTLSQGK-GDHFALSFIHAVKMYERLTIEAYLKRSKKLALKALLSH 390
gi 29828296  340 RTTLILNVRNRGALTVLDAEAVIEVPCLVDANGAHPVAVDP-LPGHATGLVCAVKAVEREVLSAAESGSRATAVKAFALH 418
gi 148271527 342 SARLILNVRNRGTLAALDADAVVEVPCVVDASGAHPVAGTE-LPDFGVGLVTNAKYVERQTIEAGLGGSRAAAVRALAHH 420
gi 15141176  355 PCYTGLNVRNEGAIEGLRNDDVVEVSCLVDGEGIRPLKIGA-MPEAQSQIVHNVKRYERLAVRAIRERSRDLAVQALMAH 433
gi 154507906 354 ILNVGNGDGGFSSIPTLRDADVVEVPCDVDASGVHPIPVAP-LEGAALGLVQSVKACENLVIDAAREHDRSLAWQALALH 432
gi 119960495 351 SPVSAPAPAAEVAVPGLPADAVVEVPCQVTPDGALPLPQER-PDGPFLTLMQHVKEVERLTIRAVVAGDREAAVQAFAAH 429
gi 50839154  353 PAELILNVANHGALPDLPDEAVVEVPCRVDGAGIHRLPTPA-LPDHARGLVVNAKYVEQRTIDAAVNHSRTAALLALSHH 431
gi 72163167  352 PARLIVNVRNRGALPGVDADAVVEVPCLVDASGARPLAVDP-LAPHQLALVHAVKAVEREVLHAVRTGSRTAALRAFATH 430
gi 163840447 333 SVELILNVRNGRTLPALASDAVIEVPSRVDSSGATPLPLLSsPTAHQLGLMAQLKAVENAVVRAVLERNREQALLAFALH 412
                        490       500
                 ....*....|....*....|....
Feature 1                                
1S6Y_A       414 PLVPSDTIAKQILDEXLEAHKEYL 437
1UP7_A       391 PLGPDVEDAKDLLEEILEANREYV 414
gi 29828296  419 PLVDSVNVARRLVDGYTSVHPGLT 442
gi 148271527 421 PLVDSVTVARSLLEDAMHAFPALS 444
gi 15141176  434 PLVLSYSRAVPLVDEYLAAHAEFA 457
gi 154507906 433 PLVDSVNVARDVLDQAIRTNPLVA 456
gi 119960495 430 PLVGSVPLGRQLLEGYEAAFPELS 453
gi 50839154  432 PLVDSVHVAEQLLDDFADAFDGLE 455
gi 72163167  431 PLVDSVAVAQRLLDGYLQAFPELA 454
gi 163840447 413 PLIGDEVLAHRLLEGYEQAFPALP 436

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap