1G0V,1DP5


Conserved Protein Domain Family
Proteinase_A_fungi

?
cd05488: Proteinase_A_fungi 
Click on image for an interactive view with Cn3D
Fungal Proteinase A , aspartic proteinase superfamily.
Fungal Proteinase A, a proteolytic enzyme distributed among a variety of organisms, is a member of the aspartic proteinase superfamily. In Saccharomyces cerevisiae, targeted to the vacuole as a zymogen, activation of proteinases A at acidic pH can occur by two different pathways: a one-step process to release mature proteinase A, involving the intervention of proteinase B, or a step-wise pathway via the auto-activation product known as pseudo-proteinase A. Once active, S. cerevisiae proteinase A is essential to the activities of other yeast vacuolar hydrolases, including proteinase B and carboxypeptidase Y. The mature enzyme is bilobal, with each lobe providing one of the two catalytically essential aspartic acid residues in the active site. The crystal structure of free proteinase A shows that flap loop is atypically pointing directly into the S(1) pocket of the enzyme. Proteinase A preferentially hydrolyzes hydrophobic residues such as Phe, Leu or Glu at the P1 position and Phe, Ile, Leu or Ala at P1'. Moreover, the enzyme is inhibited by IA3, a natural and highly specific inhibitor produced by S. cerevisiae. This family of aspartate proteases is classified by MEROPS as the peptidase family A1 (pepsin A, clan AA).
Statistics
?
PSSM-Id: 133155
View PSSM: cd05488
Aligned: 10 rows
Threshold Bit Score: 606.356
Threshold Setting Gi: 50294061
Created: 9-Jan-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 2 residues -Click on image for an interactive view with Cn3D
Feature 1:catalytic residue [active site]
Evidence:
  • Comment:The two ASPs at the active site plays key catalytic roles in the pepsin family and conserved for all family members.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                    #                                                   
1G0V_A         5 VPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSLEGY 84
gi 57223024  117 VPLSNYMNAQYFATMEIGTPFQTFKVILDTGSSNLWVPSVKCTSIACFLHSKYDSSQSSTYKANGSDFEIHYGSGSLEGF 196
gi 1039445    75 VPITNFMNAQYFSEITIGTPPQTFKVVLDTGSSNLWVPSSQCGSIACYLHNKYESSESSTYKKNGTSFKIEYGSGSLSGF 154
gi 50557048   73 SPLTNYLNAQYYTEIEIGTPPQKFNVILDTGSSNLWVPSVQCNSIACYLHQKYDSAASSSYKANGTAFEIQYGSGSMEGF 152
gi 156843876  76 VPLDNYLNAQYYTDVSIGTPPQKFKVILDTGSSNLWVPSVGCSSLACYLHSKYDHSLSSTYRSNGSDFVIQYGSGSLKGY 155
gi 71021685   97 VPLTDFLNAQYFCDISLGTPAQDFKVILDTGSSNLWVPSTKCSSIACFLHKKYDSSASSSYKKNGTEFKIQYGSGSMEGI 176
gi 116501918  89 VPLTNFMNAQYYTEITLGTPPQTFKVILDTGSSNLWVPSIKCTSIACFLHTKYDSSQSTTYKANGTEFSIQYGSGSMEGF 168
gi 50294061   81 VPLSNYMDAQYFADISLGTPPQKFKVILDTGSSNLWVPSVDCGSLACFLHNKYDHSQSSTYIKDGRPLSISYGSGSIEGY 160
gi 164657049  96 VPLTDFLNAQYFADIELGSPPQSFKVILDTGSANLWVPSESCTSIACLLHKKYDNSLSKTYQANGSEFQIHYGSGSMEGF 175
1DP5_A         5 VPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSNECGSLACFLHSKYDHEASSSYKANGTEFAIQYGTGSLEGY 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1G0V_A        85 ISQDTLSIGDLtipKQDFAEATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDLLDEkRFAFYLGdtsk--- 161
gi 57223024  197 ISQDTVSIGDLvvkKQDFAEATKEPGLAFAFGKFDGILGLGYDTISVNHIVPPFYNMLNQHLLDEpVFSFRLGssd---- 272
gi 1039445   155 VSQDRMTIGDItinDQLFAEATSEPGLAFAFGRFDGILGLGYDRLAVPGITPPFYKMVEQKLVDEpVFSFYLAdq----- 229
gi 50557048  153 VSQDTLKLGSLvlpEQDFAEATSEPGLAFAFGKFDGILGLAYDTISVNKIVPPVYNAVNRGLLDKnQFSFFLGdtnk--- 229
gi 156843876 156 ISQDTLTIGDLiipQQDFAEATAEPGLAFAFGKFDGILGLAYDSISVNKAVPPLYNAIHRGLLDKpMFAFYLGdeks--- 232
gi 71021685  177 VSNDVLKIGDLtikGQDFAEATSEPGLAFAFGKFDGILGLAYDTISVNGIVPPMYQMINQGLLDApQVSFYLGsse---- 252
gi 116501918 169 VSQDTLGIGDLtikGQDFAEALKEPGLAFAFGKFDGILGLAYDTISVNRIVPPFYNMINQKLIDSpVFAFRIGsse---- 244
gi 50294061  161 ISEDNLQIGDLtiqNQKFGETTSEPGLAFAFGKFDGILGLAYDTIAQDDITPPFYSAIQQHLLDEsKFSFYLKsvndpaa 240
gi 164657049 176 VSRDTLRIGDLdvkDQDFAEAIKEPGLAFAFGKFDGILGLAYDTISVNKIVPPFYRMKEQNLLDQnQFGFYLGsse---- 251
1DP5_A        85 ISQDTLSIGDLtipKQDFAEATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDLLDEkRFAFYLGdtsk--- 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                    #                   
1G0V_A       162 ---dtenGGEATFGGIDeskFKGDITWLPVRRKAYWEVKFEGIGLGD-EYAELESHGAAIDTGTSLITLPSGLAEMINAE 237
gi 57223024  273 -----edGGEAIFGGIDdsaYSGELQYVPVRRKGYWEVELESISFGD-EELELENTGAAIDTGTSLIVMPTDVAELLNKE 346
gi 1039445   230 -----dgESEVVFGGVNkdrYTGKITTIPLRRKAYWEVDFDAIGYGK-DFAELEGHGVILDTGTSLIALPSQLAEMLNAQ 303
gi 50557048  230 ----gtdGGVATFGGVDedyFEGKITWLPVRRKAYWEVEFNSITLGD-QTAELVNTGAAIDTGTSLLALPSGLAEVLNSE 304
gi 156843876 233 ----sknGGEATFGGYDpsrFEGEIKWLPVRRKAYWEVQFDGIKLGD-KFMKLEGHGAAIDTGTSLITLPSQIADFLNNE 307
gi 71021685  253 -----edGGEAVFGGIDdshYTGKIHWSPVKRKGYWEVALDKLALGD-EELELDNGSAAIDTGTSLIAMATDTAEILNAE 326
gi 116501918 245 -----edGGEATFGGIDheaYTGKLHYVPVRRKAYWEVELEKISFGD-DELELEHTGAAIDTGTSLIALPTDMAEMLNTQ 318
gi 50294061  241 eggsasdGGVFTLGGVDsskFKGDLIPLHVRRQAYWEVPLNAIKLGDqSTGKLENTGAAIDTGTSLITLPSDMAEIINAQ 320
gi 164657049 252 -----seGGEATFGGVDpsrFEGPIVYAPVRRRGYWEVALNKIGFGN-EELVLTRTGAAIDTGTSLIAMPTDVAEILNKE 325
1DP5_A       162 ---dtenGGEATFGGIDeskFKGDITWLPVRRKAYWEVKFEGIGLGD-EYAELESHGAAIDTGTSLITLPSGLAEMINAE 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1G0V_A       238 IGAKKGSTGQYTLDCntrdnLPDLIFNFngYNFTIGPYDYTLEvSGSCISAITPMDFPEPVGp-LAIVGDAFLRKYYSIY 316
gi 57223024  347 IGAEKSWNGQYTVDCstvssLPVLAFTFggKDYKLTGDDYILNaGGTCISSFTGMDIPAPIGp-LWIVGDVFLRKYYTVY 425
gi 1039445   304 IGAKKSWNGQFTIDCgkkssLEDVTFTLagYNFTLGPEDYILEaSGSCLSTFMGMDMPAPVGp-LAILGDAFLRKYYSIY 382
gi 50557048  305 IGATKGWSGQYTVECdkvdsLPDLTFNFagYNFTIGPRDYTLElSGSCVSAFTGFDIPAPVGp-IAIIGDAFLRRYYSVY 383
gi 156843876 308 IGAKKSWNGQYTIDCkkresLPKLTLNFynHNFTIDPFDYTLEiSGSCISAITPMDFPQPVGp-LSIIGDAFLRRFYSIY 386
gi 71021685  327 IGATKSWNGQYSVDCekvkdLPPLTFYIdgQPFKLEGKDYVLEvQGSCISSFSGINLPGPLAd-MLIVGDVFLRKYYSVY 405
gi 116501918 319 IGARKSWNGQYQVDCnkvpsLPDLTFQFggKPYPLKGSDYILNvQGTCISAFTGMDINMPGGdsLWIVGDVFLRKYYTVY 398
gi 50294061  321 IGAKKGWTGQYTLECstrakLPDLTFTLdgHDFVLSPFEYTLEvSGSCISVITPMDFPEPIGr-MAILGDAFLRRYYSVF 399
gi 164657049 326 IGAKRSWTGQYSVDCskvpsLPALTFYLdnKPYTLEGRDYIFNvQGTCISPFMGMDLPEPVGp-LWIVGDVFLRKFYTVY 404
1DP5_A       238 IGAKKGWTGQYTLDCntrdnLPDLIFNFngYNFTIGPYDYTLEvSGSCISAITPMDFPEPVGp-LAIVGDAFLRKYYSIY 316
                        330
                 ....*....|.
Feature 1                   
1G0V_A       317 DLGnNAVGLAK 327
gi 57223024  426 DLGkNAVGFAK 436
gi 1039445   383 DLGaDTVGIAT 393
gi 50557048  384 DLDhDAVGLAK 394
gi 156843876 387 DLEnNAVGLAK 397
gi 71021685  406 DLGkNAVGLAT 416
gi 116501918 399 DLGnDAVGFAP 409
gi 50294061  400 DLDaNVVSLAE 410
gi 164657049 405 DLDkDAVGFAK 415
1DP5_A       317 DLGnNAVGLAK 327

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap