Conserved Protein Domain Family
Bromo_WDR9_II

?
cd05496: Bromo_WDR9_II 
Bromodomain; WDR9 repeat II_like subfamily. WDR9 is a human gene located in the Down Syndrome critical region-2 of chromosome 21. It encodes for a nuclear protein containing WD40 repeats and two bromodomains, which may function as a transcriptional regulator involved in chromatin remodeling and play a role in embryonic development. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Statistics
?
PSSM-Id: 99928
View PSSM: cd05496
Aligned: 6 rows
Threshold Bit Score: 226.185
Threshold Setting Gi: 91094543
Created: 13-Sep-2006
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
putative
Feature 1:putative acetyllysine binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                      #    #  #                                      #   
gi 23172157  1371 HSEGDWRADCRQLLDLMWARTDSAPFREPVDTIDFPDYLEIIATPMDLRTVKEDLLGGNYDDPLDFAKDVRLIFQNSKNY 1450
gi 47125260   620 LDINAWHKQCKDLVRRMIVSSDSEPFRQPVDLFTYPDYRDIIDTPMDLGTVSETLTGGNYENPIEFAKDVRLIFSNSKAY 699
gi 97535778  1313 YVESNWKKQCKELVNLIFQCEDSEPFRQPVDLVEYPDYRDIIDTPMDFGTVRETLDAGNYDSPLEFCKDIRLIFSNAKAY 1392
gi 91094543  1159 RHASDWKSEAKILFQAIWDCEDSVPFRTPVNNLKYTDYHDIIETPMDLSTVKDKLFSDKYETPNEFYNDMRLIFQNSRTY 1238
gi 118083900 1314 YDENCWKKQCMELVNLIFQCEDSEPFRQPVDLDQYPDYRHIIDTPMDFGTVKETLEAGNYDTPMELCKDIRLIFSNAKSY 1393
gi 115627883 1362 YNSKAWIEQCKKLLKDMWDCHDSEPFRTPVDERAYPDYRGIIDHPMDLSTLKQQFALGSYRDPMDLGKDVRLMFTNAKSF 1441
                          90       100       110
                  ....*....|....*....|....*....|....*....
Feature 1         #      #                               
gi 23172157  1451 NTNKRSRIYAMTLRLSALFESHIKTVVTSWKAALRRANK 1489
gi 47125260   700 TPNKKSRIYSMTLSLSAFFENQIIPIISDYKSAVQNQRR 738
gi 97535778  1393 TPNKRSKIYSMTLRLSALFEEKMKKISSDFKIGQKFNEK 1431
gi 91094543  1239 NTNKRSRIYVMTVRLAAIFEEHISKLIKHWKMAKRRSYA 1277
gi 118083900 1394 TPNKKSKIYSMTLRLSALFEEKIRRIVSDFKNGQKQNEK 1432
gi 115627883 1442 TPNKKSRIYGMTLRLSAVFEEHFLKIIGSYRSALKYEKQ 1480

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap