Conserved Protein Domain Family
Bromo_Acf1_like

?
cd05504: Bromo_Acf1_like 
Bromodomain; Acf1_like or BAZ1A_like subfamily. Bromo adjacent to zinc finger 1A (BAZ1A) was identified as a novel human bromodomain gene by cDNA library screening. The Drosophila homologue, Acf1, is part of the CHRAC (chromatin accessibility complex) and regulates ISWI-induced nucleosome remodeling. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Statistics
?
PSSM-Id: 99936
View PSSM: cd05504
Aligned: 11 rows
Threshold Bit Score: 197.618
Threshold Setting Gi: 16768864
Created: 13-Sep-2006
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
putative
Feature 1:putative acetyllysine binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                             #    #  #                                   
gi 50749002  1411 NRRSSGRQGGVHELSAFEQLVVELVRHDDSWPFMKLVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIEDIELM 1490
gi 6683494   1540 GRRSSGRQGGVHELSAFEQLVVELVRHDDSWPFLKLVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIDDIELM 1619
gi 4884108    677 GRRSSGRQGGVHELSAFEQLVVELVRHDDSWPFLKLVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIDDIELM 756
gi 18139834   494 NRRSSGRHHGVHELSACEQLVVELVRHDDSWPFMRLVSKNQVPDYFDVIQRPIALNLIREKVNKCEYKCASEFIDDVHLM 573
gi 110756797 1180 IEQEEDKGTIKGSLGRLQELLSDIKQHRDSWPFLSPVTKDEVPDYHDIISNPMDFGTIKYKLNNNEYETLEHFFSDCHLV 1259
gi 157018532 1285 RRSRRTGDDLPLNSVALYTLIDDILKHPNSWPFNRPVSAKEVPDYYAVIKSPMDFARIKSKLNMGDYKINEQMLSDVQLV 1364
gi 7302099   1349 RSGRRTNEHMPLNSAALYDLLEQIMKHKAAWPFLRPVLTSEVPDYHQIIKTPMDLAKIKSKLNMGAYQLNEELLSDIQLV 1428
gi 16768864   273 RSGRRTNEHMPLNSAALYDLLEQIMKHKAAWPFLRPVLTSEVPDYHQIIKTPMDLAKIKSKLNMGAYQLNEELLSDIQLV 352
gi 91094197  1177 TRRDEGRTDLPLHNSALHAVLSEVMKDANAWPFLRPVQKIEVPDYYDVITKPMDFGTIKYKLNMGEYKEDAQFMADALLV 1256
gi 156551157 1245 EHEEEIKHTVKGCKHLLTQLLAEIKKNKDSWPFMAPVTKDEVPDYHDYISHPMDFGTIKTKFENDEYRTLQEFYSDCLLV 1324
gi 47214801  1417 SRRSSGRSHGLHQLSTCEQLVVELVRHPDSWPFMKLVSRTQVPDYYDIIQKPIALNTIREKVNNYKYQSAGEFVSDVRLM 1496
                          90       100       110
                  ....*....|....*....|....*....|....*
Feature 1            #   #     #                     
gi 50749002  1491 FSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLP 1525
gi 6683494   1620 FSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLH 1654
gi 4884108    757 FSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLH 791
gi 18139834   574 WSNCFEYNHHNSNEAKAGIRLQSFFITEAQNLGLE 608
gi 110756797 1260 FENCQAYNEEHSSVYNYVYRAGMRLLKYYEKRCKE 1294
gi 157018532 1365 FRNCDLYNTDETDVYRIGRDLERYVVKRCKELNLP 1399
gi 7302099   1429 FRNCDLYNVEGNEIYDAGCQLERFVIDRCRDMQLP 1463
gi 16768864   353 FRNCDLYNVEGNEIYDAGCQLERFVIDRCRDMQLP 387
gi 91094197  1257 FQNCNTYNHTEDDVYKCGVQLLRLFQKKCRELGLK 1291
gi 156551157 1325 FDNCQTYNTEHSEVYKAGMRLMKFFEKKCKDLNLN 1359
gi 47214801  1497 FSNCFQYNPRHTSEAKAGLRLQLFFNSELRKLAPP 1531

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap