Conserved Protein Domain Family
Bromo_plant1

?
cd05506: Bromo_plant1 
Bromodomain, uncharacterized subfamily specific to plants. Might function as a global transcription factor. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Statistics
?
PSSM-Id: 99938
View PSSM: cd05506
Aligned: 13 rows
Threshold Bit Score: 179.063
Threshold Setting Gi: 113565491
Created: 13-Sep-2006
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
putative
Feature 1:putative acetyllysine binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                 #      #  #                                       #   # 
gi 15232127   176 LMKQCDTLLRKLWSHPHSWVFQAPVDVVKLNIPDYLTTIKHPMDLGTVKKNLASGv-YSSPHEFAADVRLTFTNAMTYNP 254
gi 34903950   142 VFKSCGALLARLMKHKHSWVFNTPVDASALGLHDYHTIITKPMDLGTVKSRLAAGh-YKSPREFAGDVRLTFQNAMRYNP 220
gi 50253452   161 VMKECETLLNRLWSHKSGWPFRTPVDPVMLNIPDYFNVIKHPMDLGTIRSRLCKGe-YSSPLDFAADVRLTFSNSIAYNP 239
gi 30694987    69 WSSQCLALLRFLMEHRGGWLFKEPVDPVKMEIPDYFNVIQKPMDLGTVKSKLLKNv-YSNADEFAADVRLTFANAMHYNP 147
gi 29569106   168 AFKQCEAILKKLMTQKYSHIFNVPVDIVKLQIPDYFDIVKTPMDLGTVKKKLESGs-YTSPSDFAADVRLTFNNAMAYNP 246
gi 15238195   249 MMTTCGQILVKLMKHKWSWVFLNPVDVVGLGLHDYHRIVDKPMDLGTVKMNLEKGl-YRSPIDFASDVRLTFTNAMSYNP 327
gi 113565491    1 MRKRCDQILAKLRKDKRSIWFNAPVEVDRLGLQDYHAVIKCPMDLGTVRANLAAGr-YPSHDDFAADIRLTFSNALRYNP 79
gi 3033386    110 LMRQFATMFRQIAQHKWAWPFLEPVDVKGLGLHDYYKVIEKPMDLGTIKKKMESSe-YSNVREIYADVRLVFKNAMRYNE 188
gi 147826573   70 TTLQCTSILKXLMTHPAGWVFNQPVDPVALNIPDYFSIISKPMDLGTIKSKLEKNx-YLATEEFAADVRLTFANAMLYNP 148
gi 116061656  134 VHKQCLTSVRQLIAHKWGFPFAAPVDPDALDLPTYREIIKEPMDLGTVKNLIENGgkYVKAEEVDADVRLTFANAMKFNA 213
gi 42407711   162 AFKQCGNLLKNLFKHQWAGPFLAPVDVVQLNIPDYFDIIKKPMDLGTIEKKLNAGm-YSTPWDFAADVRLTFDNAVTYNP 240
gi 125558465   61 KSRQCGSILKKLMDHKSGWIFNTPVDPVVYGIPDYFDVIRNPMDLGTVKRKLTSKq-YSNPYEFAADVRLTFSNAMKYNP 139
gi 125527063  104 ALLRCGKLLDKLLEHEDGWVFAEPVDARALRLVDYYLRISDPMDLGTVRRRLERRc-YADPWAFAADVRLTFNNAMSYNS 182
                          90       100
                  ....*....|....*....|
Feature 1             #               
gi 15232127   255 PGhDVHIMGDILSKLFEARW 274
gi 34903950   221 KGqDVHFMAEQLLNMFEEKW 240
gi 50253452   240 PGnQFHTMAQGISKYFESGW 259
gi 30694987   148 LWnEVHTIAKEINEIFEVRW 167
gi 29569106   247 RGhAVHDMAIQLNKMFESRW 266
gi 15238195   328 KGqDVYLMAEKLLSQFDVWF 347
gi 113565491   80 AGhEVHTFAGDLLASFEKMY 99
gi 3033386    189 EKeDVYVMAESLLEKFEEKW 208
gi 147826573  149 PSnNVHQMAKKLNDLFNTRW 168
gi 116061656  214 EGtDVHAMAKELLVEWETRW 233
gi 42407711   241 VGnDVNLMGKTLKCIFETRW 260
gi 125558465  140 PGnDVHAIADQLNKIFDSEW 159
gi 125527063  183 AGdPVYESAAELSEIFEAGW 202

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap