Conserved Protein Domain Family
Bromo_SPT7_like

?
cd05510: Bromo_SPT7_like 
Bromodomain; SPT7_like subfamily. SPT7 is a yeast protein that functions as a component of the transcription regulatory histone acetylation (HAT) complexes SAGA, SALSA, and SLIK. SAGA is involved in the RNA polymerase II-dependent transcriptional regulation of about 10% of all yeast genes. The SPT7 bromodomain has been shown to weakly interact with acetylated histone H3, but not H4. The human representative of this subfamily is cat eye syndrome critical region protein 2 (CECR2). Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Statistics
?
PSSM-Id: 99942
View PSSM: cd05510
Aligned: 7 rows
Threshold Bit Score: 184.182
Threshold Setting Gi: 66813688
Created: 14-Sep-2006
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
putative
Feature 1:putative acetyllysine binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                            #    #  #                                    
gi 2104460    296 QRIGQEELYEAAEKVVLELRSYt---EHSLAFLTKVSKRDAPDYYTVIKEPMDLGTILRNLKNLHYNSKKEFVHDLMLIW 372
gi 66813688   304 KSEAQEEMYDQLDTVLNQLKDYs---DHSFPFLTKVRPSEAPNYYEIIKKPMDLSLMTKKLKKLEYQSKFEFQLDLNLIF 380
gi 50259931    18 VKISADAFYESLENIVNELKTS----PESIPFQKPVSKREAPDYYDVIKRPMDLSTILRNAKARKYKSKAEFAADLDLIW 93
gi 464802     438 ERIGQEELYEACEKVVLELRNYt---EHSTPFLNKVSKREAPNYHQIIKKSMDLNTVLKKLKSFQYDSKQEFVDDIMLIW 514
gi 71020763    32 GRDEREEFLESIDRIITELKNYt---EHSTAFLSKVSKRDAPDYYDVIKHPMDLGTMQKKVKSGQYKNKKQFAHDLNLIW 108
gi 85094611   339 ENVGQEELYEALDKVLTELKAHt---EYSTPFLTKVNKRDAHDYYNIIKQPMDLGTMAKRLKTLHYKSKAEFVTDLNLIW 415
gi 116509121   35 DTKLSDPFYESLDNLLADLRTItidnRDAEAFLKPVSRVEVPDYYDYITNPMDLGTMAKKVKNKQYKSKREFKDDLDLIW 114
                          90       100       110
                  ....*....|....*....|....*....|....*.
Feature 1           #   #       #                     
gi 2104460    373 SNCFLYNSHPd-HPLRVHAQFMKDKSLELINLIPDI 407
gi 66813688   381 TNCRIYNTDPsgKVYVEHANKMEKKSKDLMKNVKDL 416
gi 50259931    94 KNCFEYNSQEs-HPLRAAARFMKQKADHHLEYLADR 128
gi 464802     515 KNCLTYNSDPs-HFLRGHAIAMQKKSLQLIRMIPNI 549
gi 71020763   109 ENCLLYNSDPt-HPLRRNVAFMRKKADHLLEFISDK 143
gi 85094611   416 DNCLRYNQDLa-NPLRRMANGMRKEAEKLIPLIPDI 450
gi 116509121  115 SNCYKYNAAEd-HPLRQCVDRLKAKAERLLKHITDR 149

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap