Conserved Protein Domain Family
Bromo_polybromo_I

?
cd05524: Bromo_polybromo_I 
Bromodomain, polybromo repeat I. Polybromo is a nuclear protein of unknown function, which contains 6 bromodomains. The human ortholog BAF180 is part of a SWI/SNF chromatin-remodeling complex, and it may carry out the functions of Yeast Rsc-1 and Rsc-2. It was shown that polybromo bromodomains bind to histone H3 at specific acetyl-lysine positions. Bromodomains are found in many chromatin-associated proteins and in nuclear histone acetyltransferases. They interact specifically with acetylated lysine, but not all the bromodomains in polybromo may bind to acetyl-lysine.
Statistics
?
PSSM-Id: 99954
View PSSM: cd05524
Aligned: 11 rows
Threshold Bit Score: 176.37
Threshold Setting Gi: 7301208
Created: 13-Sep-2006
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
putative
Feature 1:putative acetyllysine binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                           #    #  #                                     
gi 951231      45 VDPIAVCHELYNTIRDYKDE--QGRLLCELFIRAPKRRNQPDYYEVVSQPIDLMKIQQKLKMEEYDDVNVLTADFQLLFN 122
gi 30721853    44 VDPIAVCHELYNTIRDYKDE--QGRLLCELFIRAPKRRNQPDYYEVVSQPIDLMKIQQKLKMEEYDDVNLLTADFQLLFN 121
gi 24370475    33 LHDLRQCAELVDALRSYRTA--DNRILCESFIRAPSRRTDPKYFDVVTHPIDLTRIQQKIKTEEYSSVEDLSADVRLLVN 110
gi 110765845   80 LDPSDLCQQLYDVLRNQKRE--DGTLLCDAFIRVPKRRQEPGYYDVVTNPIDLLKVQQKLRTDEYRDMDDLAADIQLMVN 157
gi 54648598   100 VDPIAVCHELYNTIRDYKDE--QGRILCELFIRAPKRRNQPDYYEVVSQPIDLMKIQQKLKMEEYDDVRLLTADFQLLFQ 177
gi 50417257    43 VDQIAVCHELYNTVRDYKDD--QGRQICELFVRAPKRRNQPDYYEIVSQPIDMMKIQQKLRAEEYQDVEQFSADFHLLIN 120
gi 7301208     46 LDPTELCQQLYDSIRNIKKE--DGSMLCDTFIRVPKRRQEPSYYDVVVNPIDLLKVQQKLKTDSYDDLDDLMADLELLIG 123
gi 18958139    40 EFEMAKGNYVMAQIRKHRSSa-GNNSVFESFLRLPPRRFEPEYYEQVKEPIDVTTIQHKLKIPEYLTYDQFNDDFMMFIK 118
gi 156363502   12 LDPTDLCSELYEAIRNYRSE--DGRVLCEAFIRVPKRRSSPEYYDVISTPIDLLKIQQRLKTDEYEDVGTFTADMELLLD 89
gi 115668674   37 NDPGEVIQELYDIIRNYKNE--EGKIICEALIRIPKRRTTPEYYEVVSNPIDMLKIQQRMKTEEYDTVDDMVVDVELMIN 114
gi 157744601   40 EIELVKGNYVMSKIRRQRSTagTNEPIFESFLRVPSRRLEPEYYEAVKEPIDITTIQHKLKNPDYQTFDQFQSDFDTFIS 119
                          90       100       110
                  ....*....|....*....|....*....|....*
Feature 1          #   #     #                       
gi 951231     123 NAKAYYKPDSPEYKAACKLWELYLRTKNEFVQKGD 157
gi 30721853   122 NAKSYYKPDSPEYKAACKLWDLYLRTRNEFVQKGE 156
gi 24370475   111 NNKTYYKEGSQEYKDACELWELFESHRKEMLGNAS 145
gi 110765845  158 NAKAFYMRTSPEYKDATELWELCINTKNRIMEEYE 192
gi 54648598   178 NTKAYYKPESPEYKAACKLWDLYVRTRNEFVQKGE 212
gi 50417257   121 NTKAYYQADSAEHRAASKLLNVFLSAKNELLQGGD 155
gi 7301208    124 NAKAFYIPGSSEHQDAVSLWQHIHSQRQRIMEANG 158
gi 18958139   119 NNLTYYKDESEEHKDMMKIQELFEAATAKVKSGEY 153
gi 156363502   90 NALKYYKPDSQEYQDATQLKQVFDELKEEQGSGDN 124
gi 115668674  115 NAQAYYEKNSKEHKDAIELWTVFLQSRRELLEGSE 149
gi 157744601  120 NNLAYYQKDSDEHKDMLKIQELYNAACEKVDSGEY 154

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap