Conserved Protein Domain Family
Bromo_ASH1

?
cd05525: Bromo_ASH1 
Bromodomain; ASH1_like sub-family. ASH1 (absent, small, or homeotic 1) is a member of the trithorax-group in Drosophila melanogaster, an epigenetic transcriptional regulator of HOX genes. Drosophila ASH1 has been shown to methylate specific lysines in histones H3 and H4. Mammalian ASH1 has been shown to methylate histone H3. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Statistics
?
PSSM-Id: 99955
View PSSM: cd05525
Aligned: 10 rows
Threshold Bit Score: 140.217
Threshold Setting Gi: 109465072
Created: 13-Sep-2006
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
putative
Feature 1:putative acetyllysine binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                         #         #  #                                  
gi 7739725   2443 ARLAQIFKEICDGIISYkdssrqaLAAPLLNLPPK-----KKNADYYEKISDPLDLITIEKQILTG---YYKTVEAFDAD 2514
gi 70571511   231 TLLRDAINDVFTAVMTCkdengvsVAIPFINLPSK-----TQNPEYYDHVTDPVDLSFVEQKIVTK---EYENFQEFCVD 302
gi 110762995 1695 AKLAKVLKDLYSIVATAkdendqlLCTPFITLPSK-----RKLPDYYEKISDPIDLSTIDQCIGTG---HYKTAEHFDHD 1766
gi 91077840  1091 VKLAAVLREIWNTVTKAkdennesLSTHFMTMPSK-----RKVPEFYQRITNPIDLATIEQNIATG---YYLAPESFNSD 1162
gi 108874201 1589 ARIAVALKEICIEIASLkde-rghLYLNRLTLPSK-----KKVPLYYERIPRPIDLAQIQSNIDQG---TYKQPKAFEED 1659
gi 109465072 2432 ARLAQIFKEICDGIISYkdsysvlIYNKXINLKKKkrereRNELXNFQIPVTTWWLTTICKEIXCPllvYLKTATVYSSK 2511
gi 118572535 1680 AKMAVVLRDICSAMETLkmsdlltTVSSKKKKPIKt---tLSGKLGSTAATSKVEFRSIQAQVEQG---HYKTPQEFDDH 1753
gi 118102182 2428 ARLAQIFKEICDSIIAYkdssrqaLAAPLLNLPPK-----KKNADYYEKISDPLDLATIEKQILTG---YYKTVEAFDGD 2499
gi 148725832 2357 ARLAHIFKEICDMITSYkdssgqpLAAPLLNLPSR-----KRNTQYYEKVTDPLDLSTIDKQILSG---HYKTDEAFDAD 2428
gi 115709821 2790 ARLAQVFKDIYTAVCTYrnpsgqsLAIPFMNLPSK-----KRNPDYYKRISDPVDLSTIEKNLMTG---KYKSVEAFDSD 2861
                          90       100       110
                  ....*....|....*....|....*....|....
Feature 1                #   #     #                
gi 7739725   2515 MLKVFRNAEKYYGRKSPVGRDVCRLRKAYYNARH 2548
gi 70571511   303 LQRVFRNAEKYHGRKSTLGRDVARLRRSFACARS 336
gi 110762995 1767 MIKLFDNNVRFFGRTSEMGIAAARLRKLYLGSKP 1800
gi 91077840  1163 MNRMFANYLQFYGRTKEIGVAAIKLKKVYVDAKQ 1196
gi 108874201 1660 LLIMLSNAVKYYGISSPEGVASEKLKEHYYICKQ 1693
gi 109465072 2512 MISFFCFLQKYYGRKSPIGRDVCRLRKAYYSARH 2545
gi 118572535 1754 MQQLFVEAKQQHGDDEGKEKALQSLKDSYEQQKI 1787
gi 118102182 2500 MLKVFRNAEKYYGRKSPTGRDVCRLRKAYYNARH 2533
gi 148725832 2429 MLKVFRNAEKYYGRKSAVGRDVCRLRKAYYGARH 2462
gi 115709821 2862 FLKVFKNSEKYNGKRSDLGKDAAVLRKIYLTAKA 2895

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap