Conserved Protein Domain Family
Bromo_AAA

?
cd05528: Bromo_AAA 
Bromodomain; sub-family co-occurring with AAA domains. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine. The structure(2DKW) in this alignment is an uncharacterized protein predicted from analysis of cDNA clones from human fetal liver
Statistics
?
PSSM-Id: 99957
View PSSM: cd05528
Aligned: 11 rows
Threshold Bit Score: 158.675
Threshold Setting Gi: 66810249
Created: 13-Sep-2006
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
putative
Feature 1:putative acetyllysine binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                    #    #  #                                      #   # 
gi 18390588   895 LRRLRMCLRDVCNRILYDKRFSAFHFPVTDEDAPNYRSIIQIPMDTATLLQRVDTGQYLTCTPFLQDVDLIVRNAKAYNG 974
gi 47077080   428 LRELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIKEPMDLSTVITKIDKHNYLTAKDFLKDIDLICSNALEYNP 507
gi 24021796   881 VRRMRMCLRDICNRILYNKRFNVFHFPVLEDEVPDYRSIIHKPMDMATVLQRVDSGQYLTRAAFIKDIDLIVSNAKTYNG 960
gi 47224034   842 LRELRLFLRDVTNRLSQDKRFKAFTKPVDLAEVPDYADVIKKPMDLSTVLSKIDLHRYGTVKEFLQDVDLIWQNALEYNP 921
gi 66812984  1290 VRQLRILLREMVSKIIFDKKYLSFFRDVNAEQFPEYYELIKNPMSLQRISQNLDSYEYISLESFLKDIDLIVTNTELYYH 1369
gi 156555233  683 LRELRIFLREICAKLARNRQFFMFTKPVDIEEVPDYNEIIEQPMDLETMMTKIDMHCYLCARDFLDDIDLICRNALEYNP 762
gi 115782486  971 LRELRIFLRDVLTRLASERKFRVFTSPVDPEEVPDYVEVIKQPMDLFTMNNKINLHQYTSAKQFLGDIDLITSNALEYNP 1050
gi 154147269  914 QRQMRLFFKERLTRLMRDRRFVEFVEPVDPDEAEDYYEIIETPICMQDIMEKLNNCEYNHADKFVADLILIQTNALEYNP 993
gi 66810249   992 ILNDYYFLRMVLKSLESIEQLRPFYVPVLEEEAPSYFLIIKQPMSFQQIKQSLNTYAYENTDDFWKDITLIYTNAQLFNC 1071
gi 118089085  762 LRELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIKEPMDLSTVITKIDKHNYLTAKDFLTDIDLICSNALEYNP 841
gi 47217255   542 LRELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIRQPMDLSTVVARIDTHQYLTAKDFLLDIDLICNNALEYNP 621
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
Feature 1                                                     #                       
gi 18390588   975 Ddy-------------------------------------agARIVSRAYELRDVVHGMLSQMDPALL 1005
gi 47077080   508 Dkdp------------------------------------gdKIIRHRACTLKDTAHAIIAAELDPEF 539
gi 24021796   961 Ddy-------------------------------------ngSRIVSRACELRDVVQGMLSQMDPSLV 991
gi 47224034   922 DrdpsgthtvassntgdegtgtlvgwfglvwfvshscvlgldRQIRHRACALKDTVHAIIRSELDEDF 989
gi 66812984  1370 Fndsn---------------------------------sleaIKANSRSKQLQDEVLSMVENIDPTLI 1404
gi 156555233  763 Drdp------------------------------------adKLIRHRACSLRDNAYALIKAELDSDF 794
gi 115782486 1051 Drqp------------------------------------sdRMIRNRACELKDMAYAIIDAEMDSDF 1082
gi 154147269  994 Sttk------------------------------------dgKLIRQMANTLRDAIDDLIECELDESF 1025
gi 66810249  1072 S-----------------------------------------KTSVYKASRLLQEIANKLESDCPPKV 1098
gi 118089085  842 Dkdp------------------------------------gdKIIRHRACTLKDTAHAIIAAELDPEF 873
gi 47217255   622 Dkdp------------------------------------gdKVIRHRACSLKDTAHAIFAAELDPEF 653

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap