Conserved Protein Domain Family
POLBc_B1

?
cd05530: POLBc_B1 
Click on image for an interactive view with Cn3D
DNA polymerase type-B B1 subfamily catalytic domain. Archaeal proteins that are involved in DNA replication are similar to those from eukaryotes. Some archaeal members also possess multiple family B DNA polymerases (B1, B2 and B3). So far there is no specific function(s) has been assigned for different members of the archaea type B DNA polymerases. Phylogenetic analyses of eubacterial, archaeal, and eukaryotic family B DNA polymerases are support independent gene duplications during the evolution of archaeal and eukaryotic family B DNA polymerases.
Statistics
?
PSSM-Id: 99913
View PSSM: cd05530
Aligned: 10 rows
Threshold Bit Score: 637.857
Threshold Setting Gi: 18313158
Created: 20-Jul-2007
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
active sitemetal-binding
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:Based on similarity to bacteriophage RB69 POLBc (1Q9Y)

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                        #  ###                                          
1S5J_A       447 NIRTSALIKGKGYKGAVVIDPPAGIFFNITVLDFASLYPSIIRTWNLSYETVDIQqckkpyevkdeTGEVLHIVCMDRPG 526
gi 807828    520 TTRSEALIKGKKYQGALVLDPPSGIYFNIVVLDFASLYPSIIKRWNLSYETVNPVycpes--klveVPDVGHKVCMSIPG 597
gi 126465771 461 PSTTQATIEGKKYAGALVIEPPKGVFFKVTVLDVASLYPSIIKKYNLSYETVDKPnckskidildeTGKKIHHVCIDKPG 540
gi 119719216 439 QTSTKAIIKGKKYLGAIVINPKPGVYFNVVVVDFASLYPSVIKTWNLSYETVRCQhkec---menrVPGTNHWVCKKRRG 515
gi 18313158  473 QTHTKAIIKGKKYAGAVVLDPPLGIFFDVYVLDFASLYPSIISKWNLSYETVNCRpda-----erpIPELPHTVCHDKPG 547
gi 6225283   568 GARVGAIIKDKKYRGAIVLDPPVGIFFRVLVLDFASLYPSLIKQWNLSYETVNNPncrd----tieVPEVGHRVCREFKG 643
gi 3599383   452 QVSNDAVIKDKKFRGGLVVEPEEGIHFDVTVMDFASLYPSIIKVRNLSYETVRCVhpec---rkntIPDTNHWVCTKNNG 528
gi 106364396 463 HASTTAVIKDKKYRGGFVVEPKPGVHFNVVVLDFASLYPSIIKVYNLSYETVRCVheec---ktniIPETEHWVCKKRKG 539
gi 156566467 524 TVKSSAIIKGKSYQGAFVFEPSAGIFFNVVVLDFASLYPTIIKQYNISYETVNAPkckn----yyeVPEVGHRICKDVEG 599
gi 170290793 436 RTYSQAIIKGKKYMGAIVLEPIPGIHFDVAVMDFASLYPSIIGRWKVSFETINCPhedcr--enrpVNELPHWICKKERG 513
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                    #                            #   #                                  
1S5J_A       527 ITAVITGLLRDFRVKIYKKKAKNpnnsEEQKLLYDVVQRAMKVFINATYGVFGAETFPLYAPRVAESVTALGRYVITSTV 606
gi 807828    598 LTSQIVGLLRDYRVKIYKKKAKDkslpDDVRAWYNTVQAAMKVYINASYGVFGAESFPFYAPPVAESVTAIGRYTIKQTL 677
gi 126465771 541 LSAQITGLIRDFRVGIYKKKAKSkeipIEMRAWYDVVQKAMKVFINASYGVFGAENFPLYSPAVAESVTALGRKSLYSIL 620
gi 119719216 516 LMSEIIGILRDLRVYVYKKGAKSsk-nEEERQQYDVIQSALKVFLNASYGVFGSEAFPLYCPPVAESTTALGRYSILKTM 594
gi 18313158  548 LTSTLVGILRDLRVHVYKKLAKKap-tPAERQLYDVVQSAMKVFINASYGVFGAETFPLYCPPVAELTTALARYIMTSTV 626
gi 6225283   644 ISNEIVGMLRDFRVRLYKKKSKDkslrEEERLWYDVVQSAMKVYINASYGVFGSEKFSLYSLPVAESVTALGRAVLRGTL 723
gi 3599383   529 LTSMIIGSLRDLRVNYYKSLSKSqsitEEQRQQYTVISQALKVVLNASYGVMGAEIFPLYFLPAAEATTAVGRYIIMQTI 608
gi 106364396 540 ITSLLIGSLRDLRVNYYKQLSKDktlkPEDKELYSVISQALKVILNASYGVMGADIFPLYCLPVAEATAAIGRYIITSTI 619
gi 156566467 600 ITSQIVGLLRDYRVKIYKKKAKDksldDKMKMWYDTVQSAMKVYINASYGVLGAESFELYCPPAAESITAYGRFAIKSTM 679
gi 170290793 514 IVPYLIQALRDLRVKRYKRRAKEek-dENMREWFDTVQRSLKVFLNASYGVFGYENFPLYSPPAAEMITALARKAMLLSI 592
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                       #                                                                
1S5J_A       607 KKAREEGLTVLYGDTDSLFLLNPPKNSLENIIKWVKTtFNLDLEVDKTYKFVAFSGLKKNYFGVYQDGKVDIKGMLVKKR 686
gi 807828    678 QKAGELGLRVLYGDTDSLFIWNPDEDKLRELQEYVEKnFGLDLEVDKVYKFVTFSGLKKNYIGAYEDGSIDVKGMVAKKR 757
gi 126465771 621 KKSAEIGMKVVYGDTDSIFLWAPTNEQLTKLQEWVSKnLGLEIEVDKEFVYVLFTGLKKNYIGRYVNGGIEIKGLMAKKR 700
gi 119719216 595 QKAVEMGIPVLYGDTDSLFLWNPPQEKLEELLQNILNeLQIDLSIDKEYLWVVFSKRKKNYLGLLKERKVDIKGLTGKKR 674
gi 18313158  627 LKAIELGLIPVYGDTDSLFLWNVSEEKLKKLVEYTEE-LGIDIELDKIYKFVMFSGRKKNYLGVTNDGSVIVKGIVAKKR 705
gi 6225283   724 EKSRELNLHIVYGDTDSLFIWDPPKDVLNDLVDYVERtYGLELELDKVFRAILFSGLKKNYLGITEEGDIVIKGMVAKKS 803
gi 3599383   609 SHCEQMGVKVLYGDTDSLFIKNPEERQIHDIVEHAKKeHGVELEVDKEYRYVVLSNRKKNYFGVTKSGKVDVKGLTGKKS 688
gi 106364396 620 KKCKELGIEVIYGDTDSLFLKGPSREQIESIAKWARKeLGVDLDLDKQYRYIALSERKKNYLGVLIDGNVDVKGLTGKKS 699
gi 156566467 680 DYAKKNKIAVLYGDTDSMFLWDPPQNLLDDIIEWVKNnFGLEIEIDKTYRFVAFTGLKKNYIGVYPGGEIDVKGLLGKKR 759
gi 170290793 593 DEARRMNLSVIYGDTDSLFIRGATQGQIEEFERRVEEkLGIDLELDKWYRYVVFSRLKKNYLGVTKDGSVVIKGLLGKKR 672
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1S5J_A       687 NTPEFVKKVFNEVKELMISinspndvKEIKRKIVDVVKGSYEKLKNKGYNLDELAFKVMLSKPLDAYKKNTPQHVKAALQ 766
gi 807828    758 NTPEFLKKEFSEMLAVIGSvkspedfIKVRRVIRERLRKVYHGLRDLEFNLDELAIRMALNKPVEAYTKNTPQHVKAARQ 837
gi 126465771 701 NTPEFLKQLFIELIEKLKAmstpedfKEFQEWLENEVKRLYRELKKKEITLDQLAFKVGLTKSLNEYTKNKPPHVKAALQ 780
gi 119719216 675 NTPDYIKNLFNEIVEDLSEadnvsefEKSVDKIRDLVFTAIQRLKKHEVPLDQLAFKVALTKPLKEYTKTTPQHVKAARQ 754
gi 18313158  706 NAPPIVKELVEEIINALRNinsvediSKVRETVIAMVKEVETRIREKKITLDKLGIKIVLNKNLNEYTKNKPQHVKAAEQ 785
gi 6225283   804 NTPEFIKDEFSKAVKILSKlekpedvEAILAELRDHINTVYNNVKKKVYTLDQFAIKVMLSKNPREYDKNTPQHVKAAML 883
gi 3599383   689 HTPPFIKELFYSLLDILSAvqtedefESAKLKISKAIAASGKRLEERGVPLADLAFNVMISKAPSEYVKTVPQHIRAARL 768
gi 106364396 700 HTPQFVRDAFYAVVDILSKvnteqdfEYAREEIRRIIKDYAGRLKSRKIPLEDLAFNVMVGKAPEDYKKTMPQHIRAAQL 779
gi 156566467 760 NTPQFVKEAFIKMIEMIRNsqspeevVKTREEVKNLVKELYMNLKRQYYDLDELAFHMQLTKPIESYTKNMPQHVKAAKM 839
gi 170290793 673 NIPILVKEAFDEVIKTLSEvrspedfSNAKMKIEEIIRGYVKMLESGDYDLEKLAFRCMLGKSPEDYTKTTPQHVKVARI 752
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
Feature 1                                                                     
1S5J_A       767 LRPfg------vNVLPRDIIYYVKVRSKDGVKPVQLAKVTEIDAEKYLEALRSTFEQILRA 821
gi 807828    838 LIRag------vQVLPGDVISFVKVKGKEGVKPVQLARLPEVDVEKYVESMRNVFEQLLLA 892
gi 126465771 781 LKTyg------yTVEEGDIITFVKIKGREGYKAIQLAKLYEVDPDKYIEIINSALSQLLEA 835
gi 119719216 755 LLEyrsklgisgNVEVGEIIAYVKTRNKDGVKAVQVARIDEVDNDKYIEIMRTTLQQILDA 815
gi 18313158  786 LLKyg------iNVGRGDAIIIIKTKDAVGVKPIQLARIDEIDEKKYLEYISTSLEQILEA 840
gi 6225283   884 LQRlg------lTLSRGDIVYYVKTRDKLGVKPVQLARLSDVDPGKYVEHVKTAFEQMLMA 938
gi 3599383   769 LENa-------rEVKKGDIISYVKVMNKTGVKPVEMAQAGEVDTSKYLEFMESTLDQLTSS 822
gi 106364396 780 LQDqg-----krEVKAGDIISFVKTTTPPGVKPVELARVDEVDVEKYIEYMRTTFDQILGA 835
gi 156566467 840 LAKfg------iHVNQGDVVSFVKVKGAEGVKPVQLAKLPEVDVEKYYEAIESTLGQILKA 894
gi 170290793 753 LESmg------kRVEAGQVIKYVKVIGREGVMPVELASKSQIDKEKYVEIMRSTFEQILGA 807

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap