Conserved Protein Domain Family
POLBc_zeta

?
cd05534: POLBc_zeta 
DNA polymerase type-B zeta subfamily catalytic domain. DNA polymerase (Pol) zeta is a member of the eukaryotic B-family of DNA polymerases and distantly related to DNA Pol delta. Pol zeta plays a major role in translesion replication and the production of either spontaneous or induced mutations. Apart from its role in translesion replication, Pol zeta also appears to be involved in somatic hypermutability in B lymphocytes, an important element for the production of high affinity antibodies in response to an antigen.
Statistics
?
PSSM-Id: 99917
View PSSM: cd05534
Aligned: 28 rows
Threshold Bit Score: 624.624
Threshold Setting Gi: 156089459
Created: 25-May-2007
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
active sitemetal-binding
Feature 1:active site [active site]
Evidence:
  • Comment:Based on similarity to bacteriophage RB69 POLBc (1Q9Y)

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                  #  ###                 
gi 143811385 2558 GSQYRVESMMLRIAKPMNYIPVTPSVQQRSQMRAPQCVPLIMEPE-SRFYSNSVLVLDFQSLYPSIVIAYNYCFSTCLGH 2636
gi 145477337  959 GSQFKIESILNRVTKLNDYLLLSATRVQVSTQKILECMPLVVEPP-KIFTVDPLIVLDFQSLYPSIMIAYNLCFSTCLGS 1037
gi 118357165 1163 GHQFRIEHIMNRVTDLLGYKLMSASRYGVQTQRMLECSPLTLEPP-KLFYVDPVIVLDFISLYPSIMIAYNLCFSTCLGY 1241
gi 118369112 1328 GSQFRVEGVLVRVTKQYGYLMLSASRMQVASQKILECMPLVMEPP-KMLFVDPVIVMDFQSLYPSVMIAYNYCYSTCLGN 1406
gi 164662395  883 GSQFRVESVLLRITKPRSYVLPSPNRAQVAQQNAPECLPLVLEPC-SGMYRGPVVVLDFQSLYPTMMMAYNLCYSTCVGR 961
gi 67482945   812 RGSQYKVECYLKRVSKSEFKLFSPSDNQLNSSRATDCVALVMEPQ-SGFHSNPVIVLDFLSMYPTTAIAYNICYSTCLGY 890
gi 134062264 2129 GSQFRVEATFLRLAQPLGYAMLSPSLSQVHRQPRIECIPLVMQPKsDLYRHDPVVVLDFRSLYPSVIIAYNLCYSTCLGM 2208
gi 72392719  1240 GSQYRVEATLHRMAKPMGFALLSPPLEVVHRQPRLQSMPLIMQPRsGFYKDDPVVVLDFRSLYPSIVIAYNICYTTCLGS 1319
gi 156089459  850 GSQYHVESVLLRFTKSYGYLLPSPTQRQVHEQRPSVAIPIVMQPQ-SGLHLAPVAILDFQSLYSCITIAYNICYSTCLGL 928
gi 7768485    899 GSQFKVESIMFRIAKPENYIFPSPSAKQVAEQNALEALPLVMEPK-SDLYNNPVVVLDFQSLYPSIIIAYNLCYSTCLGP 977
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 143811385 2637 VENLGkydefkfgctsl---------------------rvppdllyqvrHDITVSPNGVAFVKPSVRKGVLPRMLEEILK 2695
gi 145477337 1038 IKEEFqeggkkrfgvvatdid-------------fesllqkyqnqeelmKHILITPNNVAFLTKDVRVGIIPQILNEFLM 1104
gi 118357165 1242 IDDNFqkggfkklgvqkqwdvq-----------feellkkhnydidelmKDIFVAPNKVAFVKKSVREGVLSQITHEFFF 1310
gi 118369112 1407 INEQFnnggsgrlgvnqdahlkfe-------qlfgkdrkfnpkdmdqyhQDIFIAPNKVAYVRKTIREGILPQILHEFLL 1479
gi 164662395  962 VTPFKgsyklgftqhaelpprtaaa----pvaspatawqqqsqeqqqqdTNVYILPNGLAFVRPHIREGILPRMLHEVLS 1037
gi 67482945   891 VDDINierkigpmtys-----------------------fekenlhtlkGNIHVVANGIMFVDACVRKGILPIMLEEMLS 947
gi 134062264 2209 VQPQShgrlgvlprfkqsd----------------atlaellsddgaqhDGVVFTLNGAMFVPPSTRVGLLPQMMKAVLD 2272
gi 72392719  1320 VGKGVygrlgvlksykrddmllssllsgladtkndhngknddnensntlHGVTFTPNGCMFLTPENREGVLPQMLRVLLD 1399
gi 156089459  929 LSEHKknsgsiklgimtyype-------------egileditehrtdkgIGVHITPNGVMFVDKRVREGILPMMLKVVLQ 995
gi 7768485    978 VKIVNgkvklgfmfhs-----------------------snpnivnlikNDVYISPNGYAYVKENVRKSLLAKMLEELIE 1034
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1          #                              #   #                                           
gi 143811385 2696 TRFMVKQSMKAYKqd---rALSRMLDARQLGLKLIANVTFGYTSANFSGRMPCIEVGDSIVHKARETLERAIKLVNdtkK 2772
gi 145477337 1105 TRIMIKKSTSLYDkh---pKIQKQHGFRQLAIKLFMNVMYGYCGASFSGRMPSGDIADSVVELGRTILNQCIECINtnpA 1181
gi 118357165 1311 TRQFIKGNMGKYKqnplynHIYNKLQQRQKSLKLFMCVIFGYTGATFSGRMPLGDLADSIIQIGKFLLNQAINLINnskK 1390
gi 118369112 1480 TRIMIKKSAGFYKdd---kYLSKLLDAQQQSIKLFMCVVYGYTGASFSGRMPSVDIADSIVETGRYLLNQVCEYINsnkD 1556
gi 164662395 1038 ARIMTKHTLKRLPkea-ghVPQRRLQAQQLALKLLANVTYGYCGATASGRMPCVEIADAIVQSARETLEKAMALIEqtpE 1116
gi 67482945   948 TRQHIKERMKMFTkg---sEAYKKCFLQQLALKLLCNVVYGYTGAGLSGRMPCNEIADAIVETARQTLEKAINFAEr--K 1022
gi 134062264 2273 ARFEVQAALKHIAapledmAMEQRLQEQQLALKMLANVTYGYTAASYTGRMPCVDLAEAIVSLGRQTLERAIALIHstpA 2352
gi 72392719  1400 TRVDLQAALKHVAhpfgdiYMQQILQEQQMAIKMLANTTYGYTAASFTGRMPCADVADAIVMLGRQTLERAMWLINshpV 1479
gi 156089459  996 SRRKIKEAMKQPDmd---aISLHKLDREQHGLKMLSNLSVGLTASSYSGRMPCSDLAESVVSIARALILHCREIVHn--N 1070
gi 7768485   1035 TRNMVKRGMKDCDs----dYVNKVLNSRQLALKLIANVTYGYTSASFSGRMPCSEIADTIVETGREILSYSLEYINtldF 1110
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                   #                                                                     
gi 143811385 2773 WGARVVYGDTDSMFVLLKGATKEQSFKIGQEIAEAVTATNPKPVKLKFEKVYLPCVLQTKKRYVGYMYETldqKDPVFDA 2852
gi 145477337 1182 WQAKVLYGDTDSLFVMLPGRTVNEALLIGNQIAQHCTSLYPHPIELKFEKVYSEALLVAKKRYVGNKFEK---GEFQLDG 1258
gi 118357165 1391 WGAQVIYGDTDSVFVNIKGVSVNDAIKIGKEIESEVSKMFPYPLKLKYEKTYQNLVILTKKRYAGFFVENe-tDEPKFEA 1469
gi 118369112 1557 WYAKVVYGDTDSVFVLLKGRSVEEAFRIGKEIAESITKQYPYPIELKFEKVFRELILVSKKRYVGYKMEKi-tDKPEFLA 1635
gi 164662395 1117 WGADIVYGDTDSIFVHLPGQSKDDAFRIGHEIAERITAMNPAPVRLNFEKVYLPCMLVAKKRYAGYRFDTkeqARATLDV 1196
gi 67482945  1023 FGGKVIYSDTDSLFVEMEGKTIEESFEVGKQLCEEFNKTIPPPMKLQLEKVYWPLVTVTKKRYFGMKYEKc-eTKPTLEA 1101
gi 134062264 2353 WRAEVVYGDTDSLFVRLSGRTKTDAFRIGQEIADAVTQSNPTPIRLQLEKVLLPCLLLVKKRYAGYMWSSptqAAPTFLA 2432
gi 72392719  1480 WKAEVVYGDTDSLFVRLPGRTKEEAFAVGEEMAKEVTAVNPAPVRLQFEKVLFPCLLLVKKRYVGYAYFKpeqQEPQFLA 1559
gi 156089459 1071 FDAEVIYGDTDSIFIKFPGKNVVEAEAEAKKIAKKINEAVPEPIKILFQKVYSPCILVSKKRYLGLAHID---GQVFYDD 1147
gi 7768485   1111 CHAKVVYGDTDSLFVELPGATKEQAFDIGQQLANNITSRFPSPIRLKFEKIYFPCFLLAKKRYVGFKFESvsqKAPIFEA 1190
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 143811385 2853 KGIETVRRDSCPAVSKILERSLKLLFeTRDISLIKQYVQRQCMKLLEgkASIQDFIFAKEYRgsfs----ykpgACVPAL 2928
gi 145477337 1259 KGLEIIRRDGFPALQKIQKKAINILFkTKDLSQLKLYMQKQWAKILQdhVDIQDYIMAKEVKlgs------ykeGRLPAH 1332
gi 118357165 1470 KGLEVMRKDGCQALSIIMKNCLETLLkNKNLSAIKLYLNGEWQKLLNdqFSYRDLIISKECKle--------nyTMPPPH 1541
gi 118369112 1636 KGIEIVRRDGCDAVVKLMKKSLNILFeTKNLSKLKNYLNKQWAKILHghVNFKDFCIAKEVKlgk------ykeDRVPAH 1709
gi 164662395 1197 KGLEMIRRDGHVALQRMQETCLRILFeTHDMTAMKRYCQRQWAKLYTndVLPLYLLMSKEVRmgty-----asgASMPPG 1271
gi 67482945  1102 KGLEAVRKDSCEVVRGMMASVMKYLL-NKDIEGMKQYLEINWEMIQKgeGFIDDFVISRPYRrhy------aegRKPPIG 1174
gi 134062264 2433 KGIETVRRDQCPATALLVERLLRLLFdGASATALRRSYYAAVERLQSgaANPIQCIFRRGVRlgryr---dsgdAHLPLA 2509
gi 72392719  1560 KGIETVRRDQCPATAHLAAKMIHLLFsGAGTETLRQCFYEEVSKLQRgdCSPVDCIFRKAVKfgry-----kpnGRLPAA 1634
gi 156089459 1148 KGVETMRSSECNLTRALLKDVLESILkTKSLDTAYEQLVRAFRDLSHm-WTLKDFITYRQVRlgtyseevtgqvGTLPAA 1226
gi 7768485   1191 KGIETVRRDGTPVQQQLLRRCLEILFkTKDLSTVKKEFQNVCYQIMSgnVPVMDFCFSKEVRleky-----kelSTAPPG 1265
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 143811385 2929 ELT--RKMLTydrRSEPQVGERVPYVI------------------------------IYGTPGVPLIQlvrrpv---evl 2973
gi 145477337 1333 AVVatKIMNSd-pMRRPKGGERVPYVV------------------------------IQAQGTSKLADlvvni------y 1375
gi 118357165 1542 ARIalKEMKRd-pQTKPKYGQRIKYFI------------------------------INNPQSQRLYDcvvsvn---efm 1587
gi 118369112 1710 GIVglKITEQd-qLAKPKYGERVKYLV------------------------------VQGEQKSKVKDlvvsvp---eff 1755
gi 164662395 1272 AAVamQRMRHd-pAYMPHAAERVPYLI------------------------------QHGAPSAKLQDlalsph---ell 1317
gi 67482945  1175 TKVvlKERERd-nTFYFQYGQRVKYVV------------------------------VRTSSGKLCDSavspq-----fa 1218
gi 134062264 2510 ARValEQMEKd-vTQTPYWGERLPYVV------------------------------VRSTTAKKLADkvlhper--llq 2556
gi 72392719  1635 ARLaaLLVEKd-aMRTPYWGERIPFVV------------------------------IRRPESTRLSDrvvhpqq--lls 1681
gi 156089459 1227 AIVakYKIEKh-yGDRILENEYIPHVFthsriehysgvkggavypndvigifkphdyIKERGYKTLPQntvqsimdqikq 1305
gi 7768485   1266 AVMarRLMTKd-pRREPQYGERVPYLI------------------------------IAAAPGTTLANrsvape---efl 1311
                         490       500       510
                  ....*....|....*....|....*....|...
Feature 1                                          
gi 143811385 2974 qdpTLRLNATYYITKQILPPLARIFSLIGIDVF 3006
gi 145477337 1376 dfqSTMKLNPHYYIKQINAAVGRLFACFDIDIA 1408
gi 118357165 1588 knyRHQINLNEYLEKQINSALGRLFSTFDVDIQ 1620
gi 118369112 1756 nkfNHQMNSLYYINRQINSSIGRLFSTFDVDIK 1788
gi 164662395 1318 rvwPLALHMEYYVRRTILPALDRLLGLVGVNVY 1350
gi 67482945  1219 aseQMIIDSDYYINKQINNALQRILLPCGIDIN 1251
gi 134062264 2557 iddTHSLDATYYIVRHINSALDRLFYLVGISFA 2589
gi 72392719  1682 dedHLMLDSEYYITRHIVPTLDRMFYLVGVSCG 1714
gi 156089459 1306 ampLHLVDVDYYLKRQLFPPLQRMLQVLDTSPQ 1338
gi 7768485   1312 sssFSQLDINYYINNSLIPPLDRFLNLLGASAQ 1344

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap