Conserved Protein Domain Family
PTS_IIB_lactose

?
cd05565: PTS_IIB_lactose 
PTS_IIB_lactose: subunit IIB of enzyme II (EII) of the lactose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) found in Firmicutes as well as Actinobacteria. In this system, EII is a lactose-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane channel IIC domain. The IIC and IIB domains are expressed as a single protein from the lac operon. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include lactose, chitobiose/lichenan, ascorbate, galactitol, mannitol, fructose, and a sensory system with similarity to the bacterial bgl system.
Statistics
?
PSSM-Id: 99907
View PSSM: cd05565
Aligned: 8 rows
Threshold Bit Score: 155.639
Threshold Setting Gi: 139438375
Created: 2-May-2007
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:most of the active site residues are contained within a P-loop which forms part of a binding pocket for the phosphoryl group
  • Comment:for the E coli chitobiose transporter IIB subunit,(not included in this IIB subgroup) in addition to the P-loop residues, two conserved residues are likely to be important in catalysis: a tyrosine whose side-chain points towards the phosphorylation site and a Gln residue whose side-chain lies close to the sulfur atom of the catalytic cysteine.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1              # ## ##                                                                   
gi 131496    467 TNVLVLCAGGGTSGLLANALNKAAAEYNVPVKAAAGGYGAHREMLPEFDLVILAPQVASNFDDMKAETDKLGIKLVKTEG 546
gi 116629015 465 LNVLVLCAGGGTSGILAKSLNKLAKEDKLPLNAAAAAFGSHHDLISGMDVVILAPQMDTMKDELAKECKQNNARMITTTG 544
gi 139438375 489 KRVLVLCQGGGTSGLLANALAKAAKERGINLETAAEAYGNHVDMLPDFDLVVLAPQAASYLADLQKDCERVGNKCVACRG 568
gi 69247089  456 INVLVLCAGAGTSAMLANALKKGASESKAPISAMAGAYGSHYEMLQDFDMVVLAPQVNSYYDDIKEDTDRLGIKLVATKG 535
gi 15902469  456 LKVLVLCAGSGTSAQLANAINEGAQLAEVRVIANSGAYGAHYDIMGVYDLIILAPQVRSYYREMKVDAERLGIQIVATRG 535
gi 139438364 462 IRVLVLCQGAGTSTLLANALREGAAAKGIDLVSQSGAYGSHYETMDQYNVIVLAPQARMYYDAMKADTDRLGIKLLTTRG 541
gi 131495    477 VDVLVLCAGGGTSGILANALNKLSKERGLKLSAAARAYGQDMDLIKDMNMVILAPQMESMKGNLKKITDKYGVKLVTTTG 556
gi 15896217  458 QLVLVLCASGATSSMLANAITKGAKQEGVNVESIAMAYGQHKDVIADYDLIILAPQMASMYEELKADCASKGTKSATTTG 537
                         90
                 ....*....|....*....
Feature 1                           
gi 131496    547 AQYIKLTRDGQGALAFVQQ 565
gi 116629015 545 KQYIYMTQHANECLKLLIN 563
gi 139438375 569 KQYIELSQNGDKSLAFVSE 587
gi 69247089  536 AEYIGLTRDPEKAVQFILN 554
gi 15902469  536 MEYIHLTKNPSKSLQFVLE 554
gi 139438364 542 KEYIDLTNDPEGAIDWIVQ 560
gi 131495    557 RQYIELTNNGDMALDFVES 575
gi 15896217  538 KEYVKLTRDPVGALKFALD 556

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap