Conserved Protein Domain Family
DNA_polB_alpha_exo

?
cd05776: DNA_polB_alpha_exo 
inactive DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase alpha, a family-B DNA polymerase
The 3'-5' exonuclease domain of eukaryotic DNA polymerase alpha. DNA polymerase alpha is a family-B DNA polymerase with a catalytic subunit that contains a DnaQ-like 3'-5' exonuclease domain. It is one of the three DNA-dependent type B DNA polymerases (delta and epsilon are the other two) that have been identified as essential for nuclear DNA replication in eukaryotes. DNA polymerase alpha is almost exclusively required for the initiation of DNA replication and the priming of Okazaki fragments during elongation. It associates with DNA primase and is the only enzyme able to start DNA synthesis de novo. The catalytic subunit contains both polymerase and 3'-5' exonuclease domains, but only exhibits polymerase activity. The 3'-5' exonuclease domain contains three sequence motifs termed ExoI, ExoII and ExoIII, without the four conserved acidic residues that are crucial for metal binding and catalysis. This explains why in most organisms, that no specific repair role, other than check point control, has been assigned to this enzyme. The exonuclease domain may have a structural role.
Statistics
?
PSSM-Id: 99819
View PSSM: cd05776
Aligned: 48 rows
Threshold Bit Score: 167.404
Threshold Setting Gi: 154418827
Created: 1-Oct-2007
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 544185     539 PPLVVMSFSMKTMQNVqnhqhEIIAMAALVHHSFALDKAPPEPpfqthfcvvskpkdc---------------------- 596
gi 67484306   321 PPLNICSIETICLNEEkt--kKPMMISLDVVKSVPMSHSMKAWrddvytfy----------------------------- 369
gi 116507289  516 PPFTVMSLSVRTVVNHhenkrEVVCASTRTWHNISIDDGTPPEqlpcsvqtfiraldr---------------------- 573
gi 157070398  541 PPLTLLSLAMRTAFNPkdnkqEILAVSGRVYLDVSLSDTTPPDklasrsftavrpygsa--------------------- 599
gi 111063539  533 PPMTLMSLSLRTSFNAkenkqEILMASAMVYDNFSLSDTTPIDqmqaksftlmrpngt---------------------- 590
gi 83774919   534 PPLTLMSLAFRTQLNVkenkqEILIASARVYENVSLTDTTPPEklpcktftvmrpvgs---------------------- 591
gi 118833     522 PPMTVMSLAFRTLINKeqnkqEVVMISARIFENVDIEKGLPANdmpsysfslirplkq---------------------- 579
gi 123425608  411 PEFNLACISVKTEYDNtkkehVIRMISLRVFAKCAITKLSSNDchkatyywm---------------------------- 462
gi 154418827  295 PPLNVCVISIGTYFNEekkthEIYLLNVRVFMNHKFHKYQDNIvhtfitspspdiklrteliftnlksdksrhhsksdks 374
gi 159102577  485 PPLTIMSLALRTVVNYkenkrEIVAVSARVWRDMALENPTPPEqlpsssftavrplga---------------------- 542
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 544185         --------------------------------------------------------------------------------
gi 67484306       --------------------------------------------------------------------------------
gi 116507289      --------------------------------------------------------------------------------
gi 157070398      --------------------------------------------------------------------------------
gi 111063539      --------------------------------------------------------------------------------
gi 83774919       --------------------------------------------------------------------------------
gi 118833         --------------------------------------------------------------------------------
gi 123425608      --------------------------------------------------------------------------------
gi 154418827  375 kntnkhkeksknsksdntnkneeishisksdinksdkakasdtknqneekhkipksdtnksdkdkgekvndeifvgnetk 454
gi 159102577      --------------------------------------------------------------------------------
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 544185     597 ----------------------ifpcdfkeviskknmKVEIAATERTLIGFFLAKVHKIDPDILVGHNIcSFELEVLLQR 654
gi 67484306   370 -----------------------------inqgvkcsKGMEAKDQRELLLKVCNFIQQHDIDLIISHDM-TTTLMPFFDI 419
gi 116507289  574 ----------------------fppnfesetkkktrgQILPTQNERMLLSLLLAAINKSDPDIIIGHEFlGVSLDVLLHR 631
gi 157070398  600 ----------------------fpigfetlakernrgVLKLFKQEHEILNFLLAQIDVVDPDVILGHQLeGVDYSILLNR 657
gi 111063539  591 ----------------------afptgfqaeaaklkgNTKFVKTEQELLSLLMAMFQRHDPDVLMGHRLdDVDYSVLLNR 648
gi 83774919   592 ----------------------sypmhfeaetkrqrgTYILERSEQFLLSKFLALFEKMDPDVLMGHQLqEVDLSILLNR 649
gi 118833     580 ----------------------ifpngfeklarqhksSIFCERSEVSLLNNFLNKVRTYDPDVYFGHDF-EMCYSVLLSR 636
gi 123425608  463 ----------------------------lgniknselPGTPFNNEKDMLERFITDIQNSDIDLILSFGFnTFDGQIIAQR 514
gi 154418827  455 cdkfkddktqtrevlleaeeyvepkqedtklnanlseRVTFYSSEKKLLKNFVRLIDKLDIDILASYTMfTNDIQVIFDR 534
gi 159102577  543 ----------------------sfpprfeeqaaqgknKIKAFKFERMVLNSLLGQIQWHDADVILSHDFvGSTMDTLLHR 600
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 544185     655 INECKVp-yWSKIGRLRRSNmpklgs---rsgfgERNATCGRMICDVEISA-KELIh-cKSYHLSELVQQILKt--ERIV 726
gi 67484306   420 IESSGEvsaYSKFGRLKRTLtnikskdnkdgtfaGKTFFSGRLLADTFVLS-KEFLkseKINDLNTLTSHYLGi--QREY 496
gi 116507289  632 MKDLKVd-hWSRLGRFRRSKwpnig-----kqgtNVRFLNGRLTCDLASDAaKSMIs-sTTWSLTEMCSTHLGl--ERQD 702
gi 157070398  658 LHEKKTh-qWSRLGRLRRSQwpssivkmggnvfaERQIMSGRLLCDLANDAgKSVMtkcQTWSLTEMCSLYLGgesRRRD 736
gi 111063539  649 LREKKTp-gWHRIGRVKRSDwpknlgkgggsffaEKQLASGRLLCDLANDLgKSLMtkcQSWSLEEMCQLVLNq--RREE 725
gi 83774919   650 LKEKKTp-gWHRLGRLKRGDwpknfnr-gggffaERHLIAGRLMCDVANDMgKSLMmkcQSWSLTEMCNLYLGpgnVRQE 727
gi 118833     637 LKERKIh-nWSSIGRLRRSEwprsfnr-ssqqfvEKQIIAGRLMCDLSNDFgRSMIk-aQSWSLSEIVLKELDi--KRQD 711
gi 123425608  515 LIQLKVk-dWYRIGRLKRSFprdnit---kfsknTLLILSGRLPVDIRVSA-DEFLh-sKANDFASVIQQELGi--LVPD 586
gi 154418827  535 MKTLNVe-eWFRIGRLNRSTqikt------skynASFCLSGRIAVDIRTNL-REFLn-lPANDLSSVSLQEFGi--KRQQ 603
gi 159102577  601 MRDLKCe-nWTRLGRMRQDVskmvkq---slhalHTRMLVGRLVADLSSDTaKGMIp-sTTWSLSEMCRTHLNa--QRED 673
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|.
gi 544185     727 IPTeNIRNMYse------sSYLLYLLEHIWKDARFILQIMCELNVLPLALQ 771
gi 67484306   497 NID-DLTCSSdielalqdkNKIESIRNYLEENSRLVIKLCNQMNAIAMTKE 546
gi 116507289  703 IDPdDTANYLdgsl--sgpGKMMTFVQHCEMDAHYQMAIATKVQILPLTRQ 751
gi 157070398  737 IDNeVALKTWana----dkHGLMDYISHAETDTYFIAALALRTQILPLTKV 783
gi 111063539  726 LDNeAALKSWat-----tkEGLLNYVKHCQADAYFIAAISMKVQMLPLTKV 771
gi 83774919   728 LDGeAALKTWat-----tkDGLMNFVNHCDTDTYFVAALVLRLQMLPLTKV 773
gi 118833     712 INQeKALQSWtd-----taHGLLDYLVHCEIDTFFIAAVAFKIQMLQLSKN 757
gi 123425608  587 LET-SNFSQLif-----niPMLKKYVIANENNTAYIINLTRKIHIVPLTLQ 631
gi 154418827  604 IENvDILKEInd------rNKVISLIEFFERDTNILTKLMEKTNLLEITFR 648
gi 159102577  674 IDPeDVASFFdcta--ptpERLLTFVRHCEVDAFFQMAMACKMQLLALTKQ 722
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap