Conserved Protein Domain Family
PGM_like3

?
cd05801: PGM_like3 
Click on image for an interactive view with Cn3D
This bacterial PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily. The alpha-D-phosphohexomutases include several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.
Statistics
?
PSSM-Id: 100094
View PSSM: cd05801
Aligned: 21 rows
Threshold Bit Score: 900.074
Threshold Setting Gi: 25166381
Created: 4-Nov-2005
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 23 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:Based on the structures of Candida albicans AGM1 (N-Acetylglucosamine-phosphate mutase) and Pseudomonas aeruginosa PMM/PGM bound to their substrates and divalent metal ions.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                 # #  #                                                 
2FUV_A        23 AQLTAQYYVLKPEAGNAEH--AVKFGTSGHRGSAGRHSFNEPHILAIAQAIAEERAKNGI-TGPCYVGKDTHALSEPAFI 99
gi 56460579   20 AQLTSAYYVYEPDPRKAAE--KVSFGTSGHRGSSLKRSFNEAHILAIAQAICAYREEQGI-TGPIMVAKDTHALSESAYI 96
gi 33519786   16 TKLIDQYYNLSPDPYNNKEh-KVFFGTSGHRGSSYQYSFNEAHVFAISQSIVQIRTLYGI-TGPCYVAKDTHTLSEPAFI 93
gi 23336285   19 DEVIGKYYDLVPDPEVPEQ--RVIFGTSGHRGSSLKTSFNEAHIIAISQAIAEYRKKAGV-TGPLYLGSDTHALSGPAKK 95
gi 71892104   20 SRLITQYYTLSPDPSNGAH--NVVFGTSGHRGSSQRYSFNEAHVLAISQSIVQVRAQQGI-SGPCYIGKDTHALSEPAFI 96
gi 24373883   20 PKLMSHYYSIKPNMDAAEQ--RVTFGTSGHRGTAFQGSFNQDHIWAITQAVVDYRQSVNI-EGPLFLGIDTHALSYAAYV 96
gi 149196309  14 DQLLNIDELLLAYTDKKTNlaPVSFGTSGHRGSSLKSSFNETHILAISQAICEYRKSQNI-NGPLYVGIDTHALSKPALI 92
gi 114332149   3 TTWLNAFYSIQPDTSNPAQ--RVSFGTSGHRGSSLAGSFNELHILAIAQAVVDYCQQADI-SGPLFLGLDTHALSRPAWD 79
gi 116622008  28 DRLERTYFERAPEPEDPSQ--MVAFTTAGHRGSPLLGSFTESHVLAITQAICDFRHCVQGtDGPLYMGKDTHALSGPAQR 105
gi 16332219   38 AKLLDDYYRQQPDPENPAQ--LVSFGTSGHRGSALNGTFNEAHILAVTQAVVDYRQAQGI-TGPLYMGMDSHALSEPAQK 114
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                    ###       #         
2FUV_A       100 SVLEVLAANGVDVIVQEnn---gFTPTPAVSNAILVHNkkg--------gplADGIVITPSHNPPEDGGIKYNPPNGGPA 168
gi 56460579   97 SALDVFIGNGVEVQVQTeh---dYTPTPVLSRAIIEWNren--------takADGVVITPSHNPPEDGGFKYNPSHGGPA 165
gi 33519786   94 SVLEVLTANSINVIIEKnd---lYTPTPVISNAIINYNrhryh----nnqskADGIIVTSSHNPPEDGGIKYSSIFGGPA 166
gi 23336285   96 TAIEVLVANGVHVRVDSrd---dFVPTPVVSQAILTHNraadgtqrfegeglADGIVVTPSHNPPTDGGFKYDPVTGGPA 172
gi 71892104   97 SVLEVLAANFVDVIVQKnn---gYTPTPVISHAITQYNknhhn----nhskkADGIIITSSHNPPEDGGIKYNSIYGGPA 169
gi 24373883   97 SAIEVLAANKVTVYIQQnd---gFTPTPVVSHAIICANhaaaq----ngallSDGLIITPSHNPPQDGGIKYNPPHGGPA 169
gi 149196309  93 SCLQVLAANDVEAYYQDdf---gPSPTPVISHAILTWNeen--------kalADGIVITPSHNPPEDGGFKYNSIDGGPA 161
gi 114332149  80 VVLQVLVANQIAVFVATer---gVTATPLVSRAILAHNaqhp-------tdlADGLIITPSHNPPEDGGIKYNTPDGGPA 149
gi 116622008 106 TALEVLAANGVETIIQQdn---gVTPAPVISRAILAYNrtrk-------rglADGIVVSPSHNPPQDGGIRYSAPTGGPP 175
gi 16332219  115 TALEVLAANQVETFLTTatdltrFTPTPAVSYAILTHNqgrk-------eglADGIIITPSHNPPTDGGFKYNPPSGGPA 187
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
2FUV_A       169 DTNVTKVVEDRANALLAGGLQGVKRisldaaxasghvKAVDLVQPFVEGLADIVDXAAIQKAGLTLGVDPLGGSGIEYWK 248
gi 56460579  166 DSDVTRTIEKYANALLSSGLVGVNTcesedvlqhpklTFVDWRTQYISQLDDCIDMSAIQDAKLRLAVDAMGGSGAKYWT 245
gi 33519786  167 EIDITYLIEKYANRFLLNNLRTVNKitlnhawrsgyiHPQDLVQNYVQNLSTIINMKAIQKSGLKIGVDPLSGSSINCWY 246
gi 23336285  173 PAETTNAIAARANQLLGDFKSIKRVpyeeai-kseyvEGFDFREHYVDDLENVIDFDVIRNSGVRLGIDPLGGASVNYWP 251
gi 71892104  170 PTNITRTIEQIANKFLVNNLQHVRRmtlknawksgyiHTQDFIQNYVKKLSTIIDMQAIKTSGLKLGVHPLSGSSIDYWQ 249
gi 24373883  170 EGNITAWIESRANDYLRAALKGVNKlayadalasgyvHAIDLITPYVADLENVVDMHAIAKANLKLGVDPLGGSGIHYWA 249
gi 149196309 162 NTDITTWVENRANDIIANELKDVKKinadqvldsaniKAYDYIPNYVNDLENVIDMQAIKDAKIKIAADPLGGASLPYWE 241
gi 114332149 150 DSDVTDWIEARANQYLQKQCAEVKRmdlqd--alsqvQEYNYVAHYVAELGQVVDLPAIRQSGLKLGVDPMGGTGLPVWQ 227
gi 116622008 176 DADTAHWLETRANDLLREGNVDVHRvpvlagllaattHHEDLVMPYVRDLVSVLDMDAIKAAHIGLAVDPLGGAALPYWE 255
gi 16332219  188 EPEATQWIQNRANELLKNGNKTVKRldyeqalkatttHAHDFVTPYVAGLADIIDLDVIRSAGLRLGVDPLGGANVGYWE 267
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                       # # ##           
2FUV_A       249 RIAEHYKLNLTLVNDQVDQTFRFXHLDKDGAIRXDCSSECAXAGLLALRd-----kFDLAFANDPDYDRHGIVTp-aGLX 322
gi 56460579  246 QIAEHYNLSIEVRNAVVDPTFSFMPLDKDGKIRMDCSSPFAMASLLELKd-----nYDLAFGNDPDYDRHGIVTpthGLL 320
gi 33519786  247 DIAQYYQLNLTVINSKIDRTFSFMNIDYDGRIRINCTSELTLSKVLSSSk-----kFDLFFINDPDCDRHGIITk-gGLI 320
gi 23336285  252 LINEKYGLNIGVVRPEVDPTWRFMTIDHDGKIRMDPSSPYAMKGLVDELnagawdkYDLVGGTDPDADRHGIVCpnwGVM 331
gi 71892104  250 NIAQFYQLDLNLISEKIDKTFGFIHLDYDGCIRLDCSSEFAMAGVLKSHd-----nFDLLLVNDPDCDRHGIITp-iGLI 323
gi 24373883  250 PIAKHYGIDITLVNDKVDPSFSFMSLDKDGKIRMDCSSPYAMAGLLAHKe-----sFDLCVGNDPDYDRHGIVCpgtGLM 324
gi 149196309 242 PIVEKYGLDITVVNDSVDPTFKFMTCDRDGKIRMDCSSPWAMSSLIKLKd-----qYDIAFGNDPDSDRHGIVTrssGLL 316
gi 114332149 228 ALALDPAFNITVVNTSQAADFAFMPPDHDGRIRMDCSSPAAMANLLKIRq-----qFDLSLANDPDADRHGIVDa-aGLM 301
gi 116622008 256 PIADLYGLDLTILNPVIDPSFAFMTVDHDGLIRMDCSSPFALTQLVALKd-----rYSLSFANDPDADSHAVVTpgaGLL 330
gi 16332219  268 PIAAKYNLNISLVNPGVDPTFKFMTLDWDGKIRMDCSSPYAMASLVKIKd-----hYDIAFGNDTDGDRHGIVTpsvGLM 342
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                        #                    ###                # # #   
2FUV_A       323 NPNHYLAVAINYLFQ-HRPlWGk-DVAVGKTLVSSAXIDRVVNDLGRKLVEVPVGFKWFVDGLFDGSFGFGGEESAGASF 400
gi 56460579  321 NPNHYLSVAIDYLCK-NRD-WDs-SIAIGKTLVSSAMIDRVVGANERPLMEVPVGFKWFAKGLFERSIAFAGEESAGATL 397
gi 33519786  321 QSNYYFPIVINYLFH-NRDfWKkkILSVGKTNVSSMSIDQVANNLNCQLLTTPVGFKWFTQGLLHSKLGFAGEDSSGASF 399
gi 23336285  332 NPNHYIAVCVEYLFGgNRPgWPe-GAAVGKTLVSSSLIDRVAASINAKVIEVPVGFKWFVDPLFSGEVAFGGEESSGMSF 410
gi 71892104  324 KPNHYLIIAAHYLFN-NRPlWRnrSLFIGKTYVSSIMMNHVAYDLSRQLIEVPVGFKWFVRGLFNSLFGFVGEESAGASF 402
gi 24373883  325 DPNHYLAVAIDYLLT-HRPeWSd-SLAIGKTLVSSALIDKICVFHGKKLLEVPVGFKWFVDGLAEATIAFGGEESAGAAF 402
gi 149196309 317 NPNHYLSVAIKYLYE-NRTeWNq-NLEVGKTLVSSSMIDKVGSEIKRTICEVPVGFKWFVDGLVSQKIAFGGEESAGASF 394
gi 114332149 302 NPNHFLCVCVDYLLT-YRPlWSk-SLKIGKTLVTSSLMDRIVAAHDRELYEVPVGFKWFVKGLHQSWLAFAGEESAGASL 379
gi 116622008 331 PPNHYLAVSIQYLLA-HRShWHr-RAGVGKTLLASSIIDRIVRKLGGRLCEVPPGFEWLAPGISDGSFSFGCDENAGATF 408
gi 16332219  343 NPNHFLSVAIWYLFS-QRQqWSg-LSAIGKTLVSSSMIDRVGAMINRQVYEVPVGFKWFVSGLLDGSFGFGGEESAGASF 420
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
2FUV_A       401 LRFDGTPWSTDKDGIIXCLLAAEITAVTgKNPQEHYNELAARFGa-pSYNRLQASATSAQKAALSKLSPEXVSASTLAGD 479
gi 56460579  398 LDRKGNTWTTDKDGIVMALLAAEILTKTgKNPGQYYDDLCQQHGt-aYYRRVDTASSVQKNARFKDIRAYKVKLPELAGD 476
gi 33519786  400 LDQRCMPWSTDKDGFIMCLISAEILAVTdHTLQDHHIQFNKNLNctfNYNQTYLVINHSQKKSIINTLFNQIHMNELVGD 479
gi 23336285  411 LRKDGRVWTTDKDGLIPDLLAAEITAKTgKNPAQLHQEQVERFGe-sWYKRVDTPTTLEQKAKFAALSGDDVTASTLAGE 489
gi 71892104  403 LDFYCSPWSTDKDGLIMCLLAAEMIAISdKSLQKYYDQLVQNFGi-sNYNRIQLPINYTQKSIISNTLFNQINMTELADD 481
gi 24373883  403 LRRDGTTWCTDKDGFILVLLAAEMLAVTgKTPGQRHQELVAQFGq-sFYKRIDSPISLENKAKFAKLNADTLNATMLAGE 481
gi 149196309 395 LRKNGKVWTTDKDGIILCLLAAEILAVTkKDPGQLYQELTETHGa-pIYARIDAAASPEQKDKLKKLSPEDISATSVAGF 473
gi 114332149 380 LTFDGQTWTTDKDGIALCLLAAEISAVTgLTPSQYYAKLTEQYGr-pYYRRIDAPATAEQKAVFKTLTVAHITATELAGE 458
gi 116622008 409 LQHDDTAWTTGKDGLVMNLLAAEIAARTgRDPGELYSMVAAEVGp-hWYSRTEAPAAPQQKTKLVRLGPAAVRQSHLAGQ 487
gi 16332219  421 LKKNGTVWTTDKDGTIMDLLAAEITAKTgKDPGLHYQDLTAKLGn-pIYQRIDAPATPAQKDRLKKLSPDDVTATSLAGD 499
                        490       500       510       520       530       540
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
Feature 1                                       # ###    #                       
2FUV_A       480 PITARLtaapg-ngasIGGLKVXTDNGWFAARPSGTEDAYKIYCESFLgeEHRKQIEKEAVEIV 542
gi 56460579  477 SVSDIStkaag-ndaqFGGIKVTTDNGWFAARPSGTEPVYKIYAESFVseQHLDDILEQATTWV 539
gi 33519786  480 PIIKVEnikplnkfisMDGLKIVTRNGWIAGRLSGTELVYKIYCESFLssDHRLKMEQKMIRCI 543
gi 23336285  490 DITAKLteapg-nhakIGGLKVTTKDNWFAARPSGTENIYKVYAESFVspEALDKVLDEATVVV 552
gi 71892104  482 PITKIInmsslknqisMDGVKIITHNGWVACRLSGTESVYKIYCESFLsvSHRKKIEKEIISII 545
gi 24373883  482 KIEAVLthapg-nnasIGGIKVTTTNGWFAARPSGTEALFKIYGESFIseQHLAEIIKDAQALI 544
gi 149196309 474 PILEKLshasg-ngaaIGGLKVTTESGWFAARPSGTEDIYKIYAESFIseEHLKELQKDAQEIV 536
gi 114332149 459 PIELVLlnapg-ngasIGGIKVCTENGWFAARPSGTEALYKIYAESFIseQHLQQLIDEGQTLL 521
gi 116622008 488 PILAKLnrapg-nnapIGGLKVVAASGWFAAYPSNSENLYRIYAESFEsqEHLDQIQGEAREIV 550
gi 16332219  500 AITAKLtkapg-nqaaIGGLKVTTAEGWFAARPSGTENVYKIYAESFKdeAHLQAIFTEAEAIV 562

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap