Conserved Protein Domain Family
Ig_LP_like

?
cd05877: Ig_LP_like 
Immunoglobulin (Ig)-like domain of human cartilage link protein (LP)
Ig_LP_like: immunoglobulin (Ig)-like domain similar to that that found in human cartilage link protein (LP), also called hyaluronan and proteoglycan link protein. In cartilage, chondroitin-keratan sulfate proteoglycan (CSPG), aggrecan, forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Statistics
?
PSSM-Id: 143285
View PSSM: cd05877
Aligned: 12 rows
Threshold Bit Score: 154.413
Threshold Setting Gi: 47214540
Created: 11-Jan-2008
Updated: 18-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 130310     53 RGGNVTLPCKFyrdptaf-gsgihkIRIKWTklt-sdYLKEVDVFVSmgyhkktyggyqgRVFLKGGSDSDASLVItdLT 130
gi 47228555   20 RGGNATLPCKIqrdqsl---apnrkMRIKWTklt-sdYLKEVDVFVAmdyhkrsygsfhgRVHLQGSSPMDASLVIteIT 95
gi 47085841   64 QGSNVTLPCHYryepal---saprrTRVKWFwqpvngEGQEHDVMVAigtrhrsygdfkgRVRLRRSTPGDASLVInpLQ 140
gi 45382731   53 RGGNVTLPCKFyhehtstagsgthkIRVKWTklt-sdYLKEVDVFVAmghhrksygkyqgRVFLRESSENDASLIItnIM 131
gi 113678501  24 RGGTITLPCRYhheped---idpnrIRIKWTkv--sdAFQFEDVFVAlgrqqkafgsyqeRVSLEQAGPGDASVIIhnIT 98
gi 50417764   97 RGGNATLPCTFhyepkl---nstrkYRVKWSklh-kdNTKERDVLVAiglrhrsfgeykgRVHLIQKMPNEVSLVItdLR 172
gi 134085246  47 RGHAAILPCVMrfk--------pshYRVKWTklepssRGVENIVLITnghadkqygsvgpRAALQRAHDLDVSLRLsdLE 118
gi 47214540   79 RGEDVALPCILrtk--------psqYKVKWSkvevetVEREKVIIISsgdayktyghlgrRASLRRAHVLDASLQLsrLE 150
gi 47226733  591 PGGNATLPCRLlskr------hnpgVQVRWTkle-ndEAPLEDVLLWlgtrsktfgrfenRVFLQAADDRDASLVItdIA 663
gi 148745617  33 RGDNITLPCRLdgqs------tlfgNRIKWTki--edDSTETDVLISmgfhkkaygsyqdRAYLLEVDDSDATLVItdLD 104
gi 47605665   62 QGASVTLPCHYhyepal---asprhVRVKWWkls-enGAPEQDVLVVigqrhrsfgdyqgRVQLRQDKQQEVSLELrdLR 137
gi 118095905  63 SGVNVTLPCHYhhepes---eakhkIRIKWSklr-ddYTKEQDVLVAigktymafgdfqgRAHLHRAGQREASLLIsdVR 138
                         90       100       110
                 ....*....|....*....|....*....|
gi 130310    131 LEDYGRYKCEVIEGLEDDTVVVALDLQGVV 160
gi 47228555   96 LEDYGRYKCEVIDGLEDGTAVVTLDLEGIV 125
gi 47085841  141 SDDTGRYRCEIIDGLEDESVTMQLKFRGVV 170
gi 45382731  132 LEDYGRYKCEVIEGLEDDTAVVALNLEGVV 161
gi 113678501  99 LEDYGRYECEVTNDMEDDTGFVNLDLEGVV 128
gi 50417764  173 LEDYGNYKCEVIDGLEDESGIVELELRGVV 202
gi 134085246 119 LEDDGSYRCELINGIEDESVIITLRIEGVV 148
gi 47214540  151 LEDGGRYRCQLIHDLHDESVLVALRIRGIS 180
gi 47226733  664 TEDIGQYRCEVSDGMKHTAEEGFLKVQGCV 693
gi 148745617 105 VNDYGTYRCEFIDGMNDMTLEVDLEVQGVV 134
gi 47605665  138 LEDSGRYRCEVIDGLEDESGLVELELRGVV 167
gi 118095905 139 LQDDGKYRCEVIDGLEDASDVVELRLRGGG 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap