1QDM,1QDM


Conserved Protein Domain Family
phytepsin

?
cd06098: phytepsin 
Click on image for an interactive view with Cn3D
Phytepsin, a plant homolog of mammalian lysosomal pepsins.
Phytepsin, a plant homolog of mammalian lysosomal pepsins, resides in grains, roots, stems, leaves and flowers. Phytepsin may participate in metabolic turnover and in protein processing events. In addition, it highly expressed in several plant tissues undergoing apoptosis. Phytepsin contains an internal region consisting of about 100 residues not present in animal or microbial pepsins. This region is thus called a plant specific insert. The insert is highly similar to saponins, which are lysosomal sphingolipid-activating proteins in mammalian cells. The saponin-like domain may have a role in the vacuolar targeting of phytepsin. Phytepsin, as its animal counterparts, possesses a topology typical of all aspartic proteases. They are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localized between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. This family of aspartate proteases is classified by MEROPS as the peptidase family A1 (pepsin A, clan AA).
Statistics
?
PSSM-Id: 133162
View PSSM: cd06098
Aligned: 25 rows
Threshold Bit Score: 599.358
Threshold Setting Gi: 157336258
Created: 8-Jan-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 2 residues -Click on image for an interactive view with Cn3D
Feature 1:catalytic residue [active site]
Evidence:
  • Comment:The two ASPs at the active site plays key catalytic roles in the pepsin family and conserved for all family members.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                    #                                                   
1QDM_C        44 VALKNYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHSRYKAGASSTYKKNGKPAAIQYGTGSIAG 123
gi 13897888   72 VSLNNYLDAQYYGEISIGSPPQNFTVIFDTGSSNLWVPSSKCYLSIACYFHSKYKSSKSSTYTQIGKSCSITYGSVSISG 151
gi 12231178   72 VYLKNYLDAQYYGEIGIGSPPQKFSVIFDTGSSNLWVPSSKCYFSVACYFHSKYKSSKSSTYTKIGKSCEIDYGSGSISG 151
gi 78099760   67 VPLVDYLNTQYYGVIGLGSPPQNFTVIFDTGSSNLWVPSAKCYFSIACYLHSRYNSKKSSSYKADGETCKITYGSGAISG 146
gi 157346962  73 VSLKNYLDAQYFGEIGIGTPPQNFTVVFDTGSSNLWVPSSKCYFSIACFFHNKYKARLSSTYTKIGRPGEIHYGSGSISG 152
gi 157336258  73 VYLKNYMDAQYYGEIGIGSPPQTFSVVFDTGSSNLWVPSSKCYFSIACYFHARYRAVLSRTYSKNGRHCKINYGSGSISG 152
gi 82623417   73 VPLKNYLDAQYYGEIGIGSPPQKFKVIFDTGSSNLWVPSSKCYFSIACWIHSKYKASKSSTYTRDGESCSIRYGTGSISG 152
gi 115436054  66 VPLDNYLDTQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSVKCYFSIACYLHHRYKSKGSSSYKKNGESCSISYGSGSIAG 145
gi 114786427  70 VSLKNYLDAQYYGEISIGSPPQKFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYKSSKSSTYTKIGTSCSITYGSGSISG 149
gi 4582534    75 VALTNDRDTAYYGEIGIGTPPQNFAVIFDTGSSDLWVPSTKCDTSLACVIHPRYDSGDSSTYKGNGTTASIQYGTGAIVG 154
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1QDM_C       124 YFSeDSVTVGDLVVKDQEFIEATKEPGITFLVAKFDGILGLGFKEISVGKAVPVWYKMIEQGLVSDPVFSFWLNRHVDEG 203
gi 13897888  152 FLSqDDVQLGDLLVKDQVFIETTREPSLTFIIAKFDGILGLGFQEISVENVVPVWYDMVEQGLVDEPVFSFWLNRDPKAE 231
gi 12231178  152 FFSqDIVEVGNLAVKNQVFIEASREKSLTFALAKFDGILGLGFQEISVGDVVPVWYNMVEQGLVSEKVFSFWFNRDPKAK 231
gi 78099760  147 FFSkDNVLVGDLVVKNQKFIEATRETSVTFIIGKFDGILGLGYPEISVGKAPPIWQSMQEQELLADDVFSFWLNRDPDAS 226
gi 157346962 153 FFSqDNVEVGSLVVKDQVFIEATREGSLTFALAKFDGIMGLGFQGISVGNATPVWSTMLQQGLLHEELFSFWLNRNPNAN 232
gi 157336258 153 FFSqDHVQIGEIVIKNQVFTEATKEGLFAFSLAQFDGILGLGFQNASVGKIPPIWYNMVQQSLVSMEIVSFWLNRDPKAK 232
gi 82623417  153 HFSmDNVQVGDLVVKDQVFIEATREPSITFIVAKFDGILGLGFQEISVGNTTPVWYNMVGQGLVKESVFSFWFNRDANAK 232
gi 115436054 146 FFSeDSVLVGDLAVKNQMFIETTREPSLTFIIGKFDGILGLGFPEISVGGAPPIWQGMKEQQLIEKDVFSFWLNRDPDAP 225
gi 114786427 150 FLSqDNVGVGDLVVKDQVFIETTKEPSLTFVLAKFDGLLGLGFQEISVEDVVPVWYNMVEQGLVDEPVFSFWLNRDTNAE 229
gi 4582534   155 FYSqDSVEVGDLVVEHQDFIETTEEDDTVFLKSEFDGILGLGFQEISAGKAVPVWYNMVNQGLVEEAVFSFWLNRNVDEE 234
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                               #                        
1QDM_C       204 eGGEIIFGGMDPKHYVGEHTYVPVTQKgYWQFDMGDVLVGGKSTGFCAGGCAAIADSGTSLLAGPTAIITEINekigaag 283
gi 13897888  232 vGGELVFGGVDPKHFKGEHTYVPVTQKgYWQIDLGDFLIGNSSTGYCEGGCAVIVDSGTSLLTGPTAVVTEINyaigpeg 311
gi 12231178  232 iGGEIVFGGIDEKHFVGEHIYVPITRKgYWQFEMGNFLIGNYSTGFCRGGCDAIVDSGTSLLAGPMHVVTEVNhaigaeg 311
gi 78099760  227 sGGELVFGGMDPKHYKGDHTYVPVSRKgYWQFNMGDLLIDGHSTGFCAKGCAAIVDSGTSLLAGPTAIVAQVNhaigaeg 306
gi 157346962 233 eGGEIVFGGVDKRHFRGKHTFVPVTQAgYWQFRMGDFLISNQTTGVCEGGCSAIVDSGTSLIAGPTLVVTQINhaigaeg 312
gi 157336258 233 iGGEVIFGGVDWRHFMGDHTFVPITRKdYWQIEVGDILIAGSSTGFCEGGCAAIVDTGTSMIAGPTTVVTQINhaigaeg 312
gi 82623417  233 eGGELVFGGVDPKHFKGNHTYVPLTQKgYWQFNMGDFLIGNTSTGYCAGGCAAIVDSGTSLLAGPTTIVTQINhaigaeg 312
gi 115436054 226 tGGELIFGGVDPNHYKGSHTYVPVTRKgYWQFEMGDLLIDDYSTGFCSGGCAAIADSGTSLLGGPTTIVAQINhaigaeg 305
gi 114786427 230 eGGELIFGGVDPNHFKGKHTYVPVTQKgYWQFEMGDFLIGNSSTGFCEGGCAAIVDSGTSLLTGPTTIVTEINhaivtei 309
gi 4582534   235 eGGELVFGGVDPNHFRGNHTYVPVTRKgYWQFEMGDVLIGDKSSGFCAGGCAAIADSGTSFFAGPTAIITQINqaigakg 314
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1QDM_C       284 vvsqecktivsqygqqildlllaetqpkkicsqvglctfdgtrgvsagirs----vvddepvksnglradpmcsacemav 359
gi 13897888  312 vvcaeckevvseygemiwdllvsglradqvcselglcflngawhessiik------tvvekeaegnltsnplcttcemav 385
gi 12231178  312 iasmeckevvyqygdmiwdllvsgvqpdkicsqlalcfndaqflsigiktv-----ierenrknssvaddflctacemav 386
gi 78099760  307 iisteckevvseygemilnlliaqtdpqkvcsqvglcmfdgkrsvsngi---------esvvdkenlgsdamcsvcemav 377
gi 157346962 313 ivsmeckevvsqygnmmwdllvsgvlpskvcsqiglcmasvlwcspgirtv----vekekmesveevgdvvfcnacemia 388
gi 157336258 313 ivsfncknvvnkygrliwqflvsgfqpenvcsdiglcayngtknarqg----------agmetvigngdnaactfcemia 382
gi 82623417  313 ivsmecktivsqygemiwdllvsgvrpdqvcsqaglcfvdgaqhvssnirt-----vveretegssvgeaplctacemav 387
gi 115436054 306 ivsmeckqvvrdygdmilemliaqaspmklcsqiglcafdgtrsvrnni---------esvvdkekvgsdlsctacemav 376
gi 114786427 310 nhaigaegvvsteckeivsqygnmiwdllvsgvkpdevcsqvglcffngaagsnigmvvekdnegksssdpmctacemav 389
gi 4582534   315 vlnqqcktlvgqygknmiqmltsevqpdkicshmklctfdgahdvrsmie-------svvdknndkssggeictfcemal 387
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1QDM_C       360 vwmqnqlaqnktqdlildyvnqlcnrlpspmgeSAVDCGSLGSMPDIEFTIggKKFALKPEEYILKVGEGAAAQCISGFT 439
gi 13897888  386 iwlqnqlkqkgikekvfeyvdqlceklpspdgeSVIDCNSISSMPNVTFVIgdKDFVLTPEQYILKTGEGIAAVCVSGFL 465
gi 12231178  387 vwiqnqlrrevtkekvlnyinelcdslpspmgeSVIDCDSIPYMPNVTFTIgeKPFKLTPEQYVLKAGEGDAMVCLSGFI 466
gi 78099760  378 vwienqlrenktkelilnyanqlcerlpspngeSTVSCHQISKMPNLAFTIanKTFILTPEQYIVKLEQGGQTVCISGFM 457
gi 157346962 389 vwiqsqlkqmktkdkvlryvtelcgslpspmgeSVIDCTSVANMPNITFIIgdKAFDLTPDQYILRTGDGSATVCLSGFT 468
gi 157336258 383 fwiqvqlkehkakekvfqyvnelcenlpnpggkDFVNCDALATMPVISFAIgdKYFPLTAEQYTLKVEVNCTTVCLSGFT 462
gi 82623417  388 vwmqnqlkqagtkekvleyvnqlcekipspmgeSTIDCNSISSMPDISFTIkdKAFVLTPEQYILKTGEGVATICVSGFA 467
gi 115436054 377 vwiqnqlrhnqtrelilqyadqlcerlpspngeSAVDCDEISNMPNLSFTIanKTFTLTPEQYVVKLEQQGQTVCISGFM 456
gi 114786427 390 vwmqnqlkqkvvkekvfdyvnqlcekipspmgeSTIDCNSISNMPNVTFKIadKDFVLTPEQYILKTGEGVATICVSGFL 469
gi 4582534   388 vrmqneikrnetedniinhvnevcdqlptssaeSIVDCNGISSMPNIAFTIgsKLFEVTPEQYIYKVGEGEAATCISGFT 467
                        410       420       430
                 ....*....|....*....|....*....|....*..
Feature 1                                             
1QDM_C       440 AMDIPppRGPLWILGDVFMGPYHTVFDYGklRIGFAK 476
gi 13897888  466 ALDVPppQGPLWILGDVFMGAYHTVFDYGnlQVGFAE 502
gi 12231178  467 ALDVPppSGPLWILGDVFMGVYHTVFDFGnlKLGFAE 503
gi 78099760  458 AFDIPppRGPLWILGDVFMGAYHTVFDFGkdRIGFAK 494
gi 157346962 469 ALDVPppKGPLWILGEIFMGVYHTVFDFGdlRIGFAE 505
gi 157336258 463 ALDVPrpDGPLWVLGDVFLGAYHTIFDFGnlQVGFAK 499
gi 82623417  468 ALDVPppRGPLWILGDVFMGPYHTVFDYGksQVGFAE 504
gi 115436054 457 AFDVPppRGPLWILGDVFMAAYHTVFDFGknRIGFAE 493
gi 114786427 470 AMDVPapRGPLWILGDVFMGVYHTVFDYGnlQIGFAE 506
gi 4582534   468 ALDIMspQGPIWILGDMFMGPYHTVFDYGklRVGFAE 504

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap