Conserved Protein Domain Family
ScCit1-2_like

?
cd06105: ScCit1-2_like 
Click on image for an interactive view with Cn3D
Saccharomyces cerevisiae (Sc) citrate synthases Cit1-2_like. Citrate synthases (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) with oxaloacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). Some CS proteins function as 2-methylcitrate synthase (2MCS). 2MCS catalyzes the condensation of propionyl-coenzyme A (PrCoA) and OAA to form 2-methylcitrate and CoA during propionate metabolism. The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA. There are two types of CSs: type I CS and type II CSs. Type I CSs are found in eukarya, gram-positive bacteria, archaea, and in some gram-negative bacteria and are homodimers with both subunits participating in the active site. Type II CSs are unique to gram-negative bacteria and are homohexamers of identical subunits (approximated as a trimer of dimers). ScCit1 is a nuclear-encoded mitochondrial CS with highly specificity for AcCoA. In addition to its CS function, ScCit1 plays a part in the construction of the TCA cycle metabolon. Yeast cells deleted for Cit1 are hyper-susceptible to apoptosis induced by heat and aging stress. ScCit2 is a peroxisomal CS involved in the glyoxylate cycle; in addition to having activity with AcCoA, it may have activity with PrCoA. Chicken and pig heart CS, two Arabidopsis thaliana (Ath) CSs, CSY4 and -5, and Aspergillus niger (An) CS also belong to this group. Ath CSY4 has a mitochondrial targeting sequence; AthCSY5 has no identifiable targeting sequence. AnCS encoded by the citA gene has both an N-terminal mitochondrial import signal and a C-terminal peroxisiomal target sequence; it is not known if both these signals are functional in vivo. This group contains proteins which functions exclusively as either a CS or a 2MCS, as well as those with relaxed specificity which have dual functions as both a CS and a 2MCS.
Statistics
?
PSSM-Id: 99858
View PSSM: cd06105
Aligned: 24 rows
Threshold Bit Score: 857.821
Threshold Setting Gi: 158270890
Created: 24-Oct-2007
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 26 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:Citryl-thioester CoA is a potent inhibitor of chicken heart CS. It is extremely similar to the citryl-CoA intermediate; the only difference is that the O-3 of citrate has been substituted with two hydrogen atoms preventing hydrolysis of the compound.
  • Comment:the overall CS reaction involves both closed and open conformational forms of the enzyme.
  • Structure:6CSC_A, Gallus gallus type I CS dimer bound with citrate, contacts at 3.5 A.
    View structure with Cn3D
  • Structure:6CTS_A, Gallus gallus heart type I CS monomer bound with citryl-thioester CoA, contacts at 3.5 A.
    View structure with Cn3D
  • Citation:PMID 7120407
  • Structure:4CTS_A, Sus scrofa type I CS dimer bound with OAA, contacts at 3.5 A.
    View structure with Cn3D
  • Citation:PMID 6716477
  • Citation:PMID 9254593

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                #                                       
4CTS_A         6 LKDILADLIPKEQARIKTFRQQHGNTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGYSIPECQKmLPKAKGGE 85
6CSC_A         6 LKDVLASLIPKEQARIKTFRQQHGNTAVGQITVDMSYGGMRGMKGLIYETSVLDPDEGIRFRGFSIPECQKlLPKAGGGE 85
gi 461745     45 LKERFAEIIPAKAEEIKKFKKEHGKTVIGEVLLEQAYGGMRGIKGLVWEGSVLDPEEGIRFRGRTIPEIQReLPKAEGST 124
gi 18275806   42 LKDRLAELIPEKQAEIKKFRAEHGQDVIGEVTINQMYGGARGVRSLIWEGSVLDPNEGIRFRGYTIPECQKlLPSSPNGK 121
gi 20197191   40 LKSQLQELIPEQQDRLKKLKSEHGKVQLGNITVDMVIGGMRGMTGLLWETSLLDPEEGIRFRGLSIPECQKvLPTAQSGA 119
gi 30316357   38 LKERFAELLPENIEKIKALRKEHGSKVVDKVTLDQVYGGARGIKCLVWEGSVLDAEEGIRFRGKTIPECQElLPKAPGGK 117
gi 41019483   41 LKSQLQELIPEQQDRLKKLKSEHGKVQLGNITVDMVIGGMRGMTGLLWETSLLDPEEGIRFRGLSIPECQKvLPTAQSGA 120
gi 114155449  14 LKERLAELIPVELEHVKAVRAEHGKKAFGPVVVDQLYGGMRGLPALIWEGSVLDPEEGIRFRGKSIPECQElLPKAPGGN 93
gi 116057729   4 LKARVREAIPETNARLKAIRAAHGEKRVGEVTVGMVMGGMRGITGMLYETSLLDAEEGIRFRGHTIPDLQRrLPKATANG 83
gi 157359248  40 LHSQLKELIPEQQERLKKLKAECGKIQLGNITVDMVLGGMRGMTGLLWETSLLDPDEGIRFRGMSIPECQKvLPNATPGG 119
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
4CTS_A        86 EPLPEGLFWLLVTGQIPTEEQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGIHRT 165
6CSC_A        86 EPLPEGLFWLLVTGQIPTPEQVSWVSKEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGINRT 165
gi 461745    125 EPLPEALFWLLLTGEIPTDAQVKALSADLAARSEIPEHVIQLLDSLPKDLHPMAQFSIAVTALESESKFAKAYAQGVSKK 204
gi 18275806  122 QPLPESLFWLLVTGEIPTLSQVQALSADWAARSQLPKFVEELIDRCPPTLHPMAQFSLAVTALEHDSAFAKAYERGMNKH 201
gi 20197191  120 EPLPEGLLWLLLTGKVPSKEQVEALSKDLANRAAVPDYVYNAIDALPSTAHPMTQFASGVMALQVQSEFQKAYENGIHKS 199
gi 30316357  118 EPLPEGLFWLLLTGEVPSEQQVRDLSAEWAARSDVPKFIEELIDRCPSDLHPMAQLSLAVTALEHTSSFARAYAKGINKK 197
gi 41019483  121 EPLPEGLLWLLLTGKVPSKEQVEALSKDLANRAAVPDYVYNAIDALPSTAHPMTQFASGVMALQVQSEFQKAYENGIHKS 200
gi 114155449  94 EPLPEALFWLLVTGEVPTQEQVTALSKDWAARAAIPEFVEELLDRCPPTLHPMSQFSLAVTALNHDSNFAKAYQQGISKK 173
gi 116057729  84 EPLPEGIMWLMLTGEIPSDAEVKTLSQELAARAELPKAVHDVLDALPKNTHPMTQLSCALMAMQPESKFAKAYQDGVHKT 163
gi 157359248 120 EPLPEGLLWLLLTGKVPTKGQVDALSKELSTRATVPDHVYKAIDALPQSAHPMTQFATGVMALQVQSEFQKAYEKGIPKS 199
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                 #   #  
4CTS_A       166 KYWELIYEDCMDLIAKLPCVAAKIYRNLYReGSSIGAIDSkLDWSHNFTNMLGYtd-aQFTELMRLYLTIHSDHEGGNVS 244
6CSC_A       166 KYWEFVYEDAMDLIAKLPCVAAKIYRNLYRaGSSIGAIDSkLDWSHNFTNMLGYtd-pQFTELMRLYLTIHSDHEGGNVS 244
gi 461745    205 EYWSYTFEDSLDLLGKLPVIASKIYRNVFK-DGKITSTDPnADYGKNLAQLLGYen-kDFIDLMRLYLTIHSDHEGGNVS 282
gi 18275806  202 DYWKYEYEDCMDLIAKTVPIAGRIYRNLYR-DGVVAPIQMdKDHSYNFANVLGFanneEFVELMRLYLTIHADHEGGNVS 280
gi 20197191  200 KFWEPTYEDCLNLIARVPVVAAYVYRRMYK-NGDSIPSDKsLDYGANFSHMLGFdd-eKVKELMRLYITIHSDHEGGNVS 277
gi 30316357  198 EYWGYTFEDSMDLIAKLPTIAARIYQNVFK-GGKVAAVQKdKDYSFNFANQLGFgdnkDFVELLRLYLTIHTDHEGGNVS 276
gi 41019483  201 KFWEPTYEDCLNLIARVPVVAAYVYRRMYK-NGDSIPSDKsLDYGANFSHMLGFdd-eKVKELMRLYITIHSDHEGGNVS 278
gi 114155449 174 DYWGPVFEDCMDLIAKLPNIAGRIFRNVYG-KGKLPAIDAnKDYSWNLATLLGFgenpAFVELMRLYITIHSDHEGGNVS 252
gi 116057729 164 TFWEYAFEDSMDIIARLPAVCAAIYRRTFK-DGKLIAADKnLDWAGNFAHMMGHds-eAVKELMRLYMTIHVDHEGGNVS 241
gi 157359248 200 KYWEPTYEDSLSLIAQVPVVAAYVYRRVYK-NGQIIPKDDsLDYGANFSHMLGFds-pKMQELMRLYVTIHSDHEGGNVS 277
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                   #### #  #                                 ########  #
4CTS_A       245 AHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLVWLTQLqkevGKDVSdekLRDYIWNTLNSGRVVPGYGHAVLR 324
6CSC_A       245 AHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLLWLSQLqkdlGADASdekLRDYIWNTLNSGRVVPGYGHAVLR 324
gi 461745    283 AHTTHLVGSALSSPYLSLAAGLNGLAGPLHGRANQEVLEWLFKLreevKGDYSketIEKYLWDTLNAGRVVPGYGHAVLR 362
gi 18275806  281 AHTGHLVGSALSSPFLSMAASLNGLAGPLHGLANQEVLNFLITMkkeiGDDLSeetIKSYLWKLLNSGRVVPGYGHAVLR 360
gi 20197191  278 AHTGHLVGSALSDPYLSFAAALNGLAGPLHGLANQEVLLWIKSVveecGEDISkeqLKEYVWKTLNSGKVIPGYGHGVLR 357
gi 30316357  277 AHTTHLVGSALSSPFLSVAAGLNGLAGPLHGLANQEVLNWLTEMkkviGDDLSdeaITKYLWDTLNAGRVVPGYGHAVLR 356
gi 41019483  279 AHTGHLVGSALSDPYLSFAAALNGLAGPLHGLANQEVLLWIKSVveecGEDISkeqLKEYVWKTLNSGKVIPGYGHGVLR 358
gi 114155449 253 AHTGKLVGSALSDPFLAFAASLNGLAGPLHGLANQEVLIWLRRMqskiGENASdeaVREYVWSTLKSGQVVPGYGHAVLR 332
gi 116057729 242 AHTTHLVGSALSDPYLSLVAGLNGLAGPLHGLANQEVLKWLNETrekvGDDATkeqLTEFVWDTLKSGRVVPGYGHGVLR 321
gi 157359248 278 AHTGHLVASALADPYLSFAAALNGLAGPLHGLANQEVLLWIKSVvdecGENISteqLKDYVWKTLKSGKVVPGFGHGVLR 357
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1            #                                        #  # #                     #   #   
4CTS_A       325 KTDPRYTCQREFALKHLPHDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALG 404
6CSC_A       325 KTDPRYTCQREFALKHLPSDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALG 404
gi 461745    363 KTDPRYTAQREFALKHFPDYELFKLVSTIYEVAPGVLTKHGKTKNPWPNVDSHSGVLLQYYGLTEASFYTVLFGVARAIG 442
gi 18275806  361 KTDPRYTAQREFALEHLPKDPMFQLVSRLYEIVPGVLTEHGKTKNPYPNVDSHSGVLLQYYGLKEQSFYTVLFGVSRTLG 440
gi 20197191  358 NTDPRYVCQREFALKHLPDDPLFQLVSKLYEVVPPVLTELGKVKNPWPNVDAHSGVLLNHYGLTEARYYTVLFGVSRSLG 437
gi 30316357  357 KTDPRYSAQRKFAQEHLPEDPMFQLVSQVYKIAPKVLTEHGKTKNPYPNVDAHSGVLLQHYGLTEANYYTVLFGVSRAIG 436
gi 41019483  359 NTDPRYVCQREFALKHLPDDPLFQLVSKLYEVVPPVLTELGKVKNPWPNVDAHSGVLLNHYGLTEARYYTVLFGVSRSLG 438
gi 114155449 333 KTDPRYTAQREFALKHLPNDPMFKLVGQIYNIVPGILLEAGKAKNPWPNVDAHSGVLLTHYGLTQMNFYTVLFGVSRAFG 412
gi 116057729 322 KTDPRYTCQREFALKHLPNDPMFKLVGKLFEVVPDVLTQTGKVKNPWPNVDAHSGVLLQYYGITEENFYTVLFGASRAIG 401
gi 157359248 358 KTDPRYMCQREFALKHLPDDPLFQLVSKLYEVVPPILTELGKVKNPWPNVDAHSGVLLNHFGLHEARYFTVLFGVSRSIG 437
                        410       420
                 ....*....|....*....|....*....
Feature 1                     #  #            
4CTS_A       405 VLAQLIWSRALGFPLERPKSMSTDGLIKL 433
6CSC_A       405 VLAQLIWSRALGFPLERPKSMSTAGLEKL 433
gi 461745    443 VLPQLIIDRAVGAPIERPKSFSTEKYKEL 471
gi 18275806  441 VASQLIWDRALGLPIERPKSFSTEALKKM 469
gi 20197191  438 ICSQLIWDRALGLALERPKSVTMDWLEAH 466
gi 30316357  437 VLPQLIIDRAVGAPIERPKSYSTDKWIEI 465
gi 41019483  439 ICSQLIWDRALGLALERPKSVTMDWLEAH 467
gi 114155449 413 VAAQLIWDRALGAPLERPKSYSTGAIEKM 441
gi 116057729 402 VLSQLILSRASGYPIERPKSVTSKWIEDK 430
gi 157359248 438 ICSQLIWDRALGLPLERPKSVTMEWLENH 466

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap