Conserved Protein Domain Family
ScCit3_like

?
cd06106: ScCit3_like 
Saccharomyces cerevisiae (Sc) 2-methylcitrate synthase Cit3-like. 2-methylcitrate synthase (2MCS) catalyzes the condensation of propionyl-coenzyme A (PrCoA) and oxaloacetate (OAA) to form 2-methylcitrate and CoA. Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) with OAA to form citrate and CoA, the first step in the citric acid cycle (TCA or Krebs cycle). The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA. There are two types of CSs: type I CS and type II CSs. Type I CSs are found in eukarya, gram-positive bacteria, archaea, and in some gram-negative bacteria and are homodimers with both subunits participating in the active site. Type II CSs are unique to gram-negative bacteria and are homohexamers of identical subunits (approximated as a trimer of dimers). ScCit3 is mitochondrial and functions in the metabolism of PrCoA; it is a dual specificity CS and 2MCS, having similar catalytic efficiency with both AcCoA and PrCoA. The pattern of expression of the ScCIT3 gene follows that of the major mitochondrial CS gene (CIT1, not included in this group) and its expression is increased in the presence of a CIT1 deletion. This group also contains Aspergillus nidulans 2MCS; a deletion of the gene encoding this protein results in a strain unable to grow on propionate. This group contains proteins which functions exclusively as either a CS or a 2MCS, as well as those with relaxed specificity which have dual functions as both a CS and a 2MCS.
Statistics
?
PSSM-Id: 99859
View PSSM: cd06106
Aligned: 5 rows
Threshold Bit Score: 824.446
Threshold Setting Gi: 1168958
Created: 24-Oct-2007
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
  next features
Feature 1:active site [active site]
Evidence:
  • Comment:By similarity to type I and type II CSs.
  • Comment:Citryl-thioester CoA is a potent inhibitor of chicken heart CS. It is extremely similar to the citryl-CoA intermediate; the only difference is that the O-3 of citrate has been substituted with two hydrogen atoms preventing hydrolysis of the compound.
  • Comment:the overall CS reaction involves both closed and open conformational forms of the enzyme.
  • Citation:PMID 7120407
  • Citation:PMID 6716477
  • Citation:PMID 9254593

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                             #                                       
XP_503380  26 LKGALKEAIPAKLELFKKVKSEYSqksLGDCKVENLLGGMRGLKCMLWEGSVLDADEGIRFHGKTIKECQEVLPKAVEGg 105 Yarrowia lipolytic...
Q9TEM3     30 LKSALKAVIPAKRELLAEVKKQGDe-vIGEVKVSNVIGGMRGLKSMLWEGSVLDADEGIRFHGKTIKDCQKELPKGPTGt 108 Emericella nidulans
EAU88446   29 LRDTLKDIIPAKQEQLKKLKTEHGqtvVGDVKVENIIGGMRGLKAMLWDASVLDPIEGIRFHGLSIPDCQKVLPPAPGGk 108 Coprinopsis cinere...
1168958    29 LKEALENVIPKKRDAVKKLKACYGstfVGPITISSVLGGMRGNQSMFWQGTSLDPEHGIKFQGLTIEECQNRLPNTGIDg 108 baker's yeast
EDP45331   38 LTEAVSETVPAKREQLAKLKAEHAetkLGDSTVGHLLGGMRGLKCMLWEGSVLDAESGITFHGKSIPQCQKELPSAKDIg 117 Malassezia globosa...
Feature 1                                                                                     
XP_503380 106 ----EMLPESMLWFLFTGKVPTEEQVRGLSRELAEKg-eVPEFVNKMLDNLPPTLHPMTQFSMAVSALNHDSKFAKAYER 180 Yarrowia lipolytic...
Q9TEM3    109 ----EMLPEAMFWLLLTGEVPSTSQVRAFSKQLAEEs-hLPDHILDLAKSFPKHMHPMTQISIITAALNTESKFAKLYEK 183 Emericella nidulans
EAU88446  109 ----EIIPESMLWLLLTGQVPTSEQTRQLSRELAEKg-dLPKFVEQLVDELPKTLHPMTQLGIGVAALNHDSAFQAAYEK 183 Coprinopsis cinere...
1168958   109 ---dNFLPESMLWLLMTGGVPTFQQAASFRKELAIRgrkLPHYTEKVLSSLPKDMHPMTQLAIGLASMNKGSLFATNYQK 185 baker's yeast
EDP45331  118 rpgkEMLPESMLWLLLTGKVPTVEEAKGLSQDLVSRa-kLPNYIEKLIDTFPKSLHPMTQFSTAVAALNHDSKFAAAYNA 196 Malassezia globosa...
Feature 1                                                                                     
XP_503380 181 G-IPKSEYWEYTFDDSIDLIAKLPQIAAKIYQNsylggGPLPGKIDLNRDWSYNYAAMMGKgd--------------etG 245 Yarrowia lipolytic...
Q9TEM3    184 G-INKADYWEPTFDDAISLLAKIPRVAALVFRPne-idVVGRQKLDPAQDWSYNFAELLGKgga------------nnaD 249 Emericella nidulans
EAU88446  184 G-MKKTEYWAPTLEDCLNLIARLPALAARIYRNvy-kpGTELPAINKDLDLVGNYTNMLGYgs--------------nqN 247 Coprinopsis cinere...
1168958   186 GlIGKMEFWKDTLEDSLNLIASLPLLTGRIYSNit-neGHPLGQYSEEVDWCTNICSLLGMtngtnssntcnltsqqslD 264 baker's yeast
EDP45331  197 G-VKKTEFWQPTLEDSLDLIARLPAVAARIYYNvf-gkGDGKQNVDPSMDLAENFTHMLGYgd--------------keG 260 Malassezia globosa...
Feature 1                   #   #                             #### #  #                       
XP_503380 246 FVDLLRLYFALHGDHEGGNVSAHATHLVGSALSDPYLSYSAGLQGLAGPLHGLAAQEVLRFILDMeknVPKGYSneDLVK 325 Yarrowia lipolytic...
Q9TEM3    250 FHDLLRLYLALHGDHEGGNVSAHATHLVGSALSDPFLSYSAGLLGLAGPLHGLAAQEVLRWILAMqekIGTKFTdeDVRA 329 Emericella nidulans
EAU88446  248 LTEYLRLYIALHGDHEGGNASAHTAHLVGSTLSDPYLSYSAALFALAGPLHGLANQEVLRWQLAMqqeLGDKIThdDIRD 327 Coprinopsis cinere...
1168958   265 FINLMRLYTGIHVDHEGGNVSAHTTHLVGSALSDPYLSYSSGIMGLAGPLHGLAAQEVVRFLIEMnsnISSIAReqEIKD 344 baker's yeast
EDP45331  261 LVDYMRLYISVHGDHEGGNVSAHTAHLVGSALSDPYLAYSAALNGLAGPLHGLANQEVLNWILELekeVGSDPSdqQIID 340 Malassezia globosa...
Feature 1               ########  #    #                                           #  # #     
XP_503380 326 YLWSVLKSGRVIPGYGHAVLRKPDPRFEALMNFANSRQei-rdDPVFQLVSRTSEVATGVLTEHGKTKNPHPNVDSSSGV 404 Yarrowia lipolytic...
Q9TEM3    330 YLWDTLKSGRVVPGYGHGVLRKPDPRFQALMDFAATRKdv-laNPVFQLVKKNSEIAPGVLTEHGKTKNPHPNVDAASGV 408 Emericella nidulans
EAU88446  328 YLWKTLKSGQVVPGYGHGVLRNPDPRFIALQEFCQARPel-keSPIVQLVNKTFEVAPDVLKEHGKTKNPYPNVDATSGC 406 Coprinopsis cinere...
1168958   345 YLWKILNSNRVIPGYGHAVLRKPDPRFTAMLEFAQKRPiefenDKNVLLMQKLAEIAPKVLLEHGKSKNPFPNVDSASGI 424 baker's yeast
EDP45331  341 SLWSTLKSGRVVPGYGHAVLRQPDPRFTALSGYCDTRPel-qkSPTVKLVQRLSHLAPPVLTEHGKTKNPFPNVDAGSGA 419 Malassezia globosa...
Feature 1                     #   #                #  #         
XP_503380 405 LFHHYGIHETLYYTVTFGVSRALGPLPQLVWDRILGLPIERPKSLSLEEI 454 Yarrowia lipolytica CLIB122
Q9TEM3    409 LFYHYGFQQPLYYTVTFGVSRALGPLVQLIWDRALGLPIERPKSINLLGL 458 Emericella nidulans
EAU88446  407 VLYHYGLTEFKYYTVIFGVSRALGALTQLVWARALGLPIERPKSLSLDAL 456 Coprinopsis cinerea okayama7#130
1168958   425 LFYHYGIRELLFFTVIFGCSRAMGPLTQLVWDRILGLPIERPKSLNLEGL 474 baker's yeast
EDP45331  420 PLYTYGLDEFKFYTVLFGVSRAFGALPQLVYDRMLGLPIERPKSLSMDAL 469 Malassezia globosa CBS 7966

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap