Conserved Protein Domain Family
Ec2MCS_like

?
cd06108: Ec2MCS_like 
Escherichia coli (Ec) 2-methylcitrate synthase (2MCS)_like. 2MCS catalyzes the condensation of propionyl-coenzyme A (PrCoA) and oxalacetate (OAA) to form 2-methylcitrate and coenzyme A (CoA) during propionate metabolism. Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) and OAA to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). This group contains proteins similar to the E. coli 2MCS, EcPrpC. EcPrpC is one of two CS isozymes in the gram-negative E. coli. EcPrpC is a dimeric (type I ) CS; it is induced during growth on propionate and prefers PrCoA as a substrate though it has partial CS activity with AcCoA. This group also includes Salmonella typhimurium PrpC and Ralstonia eutropha (Re) 2-MCS1 which are also induced during growth on propionate and prefer PrCoA as substrate, but can also use AcCoA. Re 2-MCS1 can use butyryl-CoA and valeryl-CoA at a lower rate. A second Ralstonia eutropha 2MCS, Re 2-MCS2, which is induced on propionate is also found in this group. This group may include proteins which may function exclusively as a CS, those which may function exclusively as a 2MCS, or those with dual specificity which functions as both a CS and a 2MCS.
Statistics
?
PSSM-Id: 99861
View PSSM: cd06108
Aligned: 15 rows
Threshold Bit Score: 655.53
Threshold Setting Gi: 84620822
Created: 18-Oct-2007
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
  next features
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1           #                                                                            
gi 2506292    20 VALSGVPAGNTALCTVGKSgndLHYRGYDILDLAKHCeFEEVAHLLIHGKLPTRDELAAYKTKLKALRGLPANVRTVLEA 99
gi 77165673    8 SGLAGVTAGKTAISTVGKEgkgLTYRGYAIEMLAERAsFEEVAYLLIYGQSPSRAQLTEYREQLRSLRRLPEGLKPVLEA 87
gi 32265897   11 GGLAGITAGQSAICTVGTGh-gLNYRGYDIYDLARECeFEEVAYLLLKEKLPNANELAAFKKELIAARDLPKALKDTLKL 89
gi 108805204   6 VGLSGAIAGDTAICTVGSSgdsLEYRGYPIEELAERAtFEEVMHLLIRGELPDRRQLEEYTGRLSGMRKIPQELRDVLER 85
gi 118380705  10 GGLAGIVAGDSAISTVGIGm-gLNYRGYDIVDLAKNStFEDVAYLILFGKLPTSKQLEEFLDQIVKARYLPAQLKEILER 88
gi 145523265   8 GGLQGVVAGQSAISTVGVGgigLNYRGYDINDLAYKCnFEEVTYLLLKGHLPNQQQLDELRTLISQKRQIPCKLKQILET 87
gi 57168401   11 GGLAGVIAGQSAICTCGLGn-gLNYYGYSIEELAQNAeFEEIAYLLQFGELPNAKELENYKEKIIAQRALSENLKNVLKA 89
gi 29654102    6 KGLRGQSAGETSIATVGKEghgLTYRGYRIEDLAANAtFEEVAYLLLKNKLPTKSELDAYTKKLVNLRSLPPALKDTLER 85
gi 161075825   7 EGLEGIIAGKTAISTVGKEgldLTYRGYSIHDLAQNAtFEEVVFLLLYNRLPTRNQLSGFIDQLNSLRELPAALQSVLKL 86
gi 169189618   7 GGLAAVIAGQTRISTVGKEgkgLSYRGYSIYDLARFAaFEETAYLLLYGWLPDAEQLGQFRKQLTASRELPPALISILEL 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 2506292   100 LPAASHPMDVMRTGVSALGCTLPEkeght---vsgaRDIADKLLASLSSILLYWYHYSHn-GERIQPETDDd-SIGGHFL 174
gi 77165673   88 LPGNSHPMDVMRTGCSALGCLEPEinr------dqqWDIANRLLALFPSLLLYWYQFHHh-GIRIETDTEEe-SLAGHFL 159
gi 32265897   90 LPKNAHPMDIMRTTCSMLGCLEPEtydivkmsfpmqNQIAIRLLGIFPSALTFWHHYHHn-GKEISTQSNQd-SIAGHFL 167
gi 108805204  86 IPASTHPMEVLRTGCSMLGTLEHEgeg------rdaREIGERLISCLPSVLLYWHHFAGs-GKRIETDTGEh-SLAGHFL 157
gi 118380705  89 IPVDVHPMDMMRTVSSFLGLIEPEtke------ndqYKVAIRLLGIFGPAMAYWYHFAHsgVRINEQTGPKd-TIACNLV 161
gi 145523265  88 LPKESHPMDIMRTVASLVGILEPEtkp------gqeYEISIRLISLFGPALLYWYHYSNs-GIKINENTGKd-SIAENFL 159
gi 57168401   90 IPKEVHPMNLMQTAVAALGALEGEnedf-----sdqDEKIIRLLGILPSMLCYWHHYVNf-GKEIDFDSNQt-SIAGYFL 162
gi 29654102   86 IPASSHPMDVMRTGCSMLGNLEPEngf------eneQNIADRLVAIFPAIQCYWYHYSHh-GKRIDTELDDl-TLAGYFL 157
gi 161075825  87 IPQDTNPMDVLRTGCSMLGTLEPEdgh------rtqEHIAKRLLAILPSMLLFWYQYHQg-KGSIETTSESekTIASHLL 159
gi 169189618  87 LPGSAHPMDVLRTGYSALASFEPEeeg------rsaLDIAVRLIGCTSSILLYWYHYQNs-GKRIDTAGSGg-DTASHFL 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                  #  #                              ### #  #            
gi 2506292   175 HLLHGEKPs-qSWEKAMHISLVLYAEHEFNASTFTSRVIAGTGSDMYSAIIGAIGALRGPKHGGANEVSLEIQQRYetpD 253
gi 77165673  160 NLLHGESPg-aIPRRVLDASLILYAEHEFAASTFAARVTTSTLSDFYSAVTAAIGTLRGTLHGGANEAAMALIERFqepD 238
gi 32265897  168 ELLHQKPPk-eLWIKAMHASLILYAEHEFNASTFTARVITATMSDVYSGVTGAIGALRGPLHGGANEAAMELIAEYktpQ 246
gi 108805204 158 RLLHGREPg-eEERRAVDVSLILYAEHEFNASTFTARIIASTGSDFYSAITGAIGALRGPLHGGANEAAMAFIERFrsaE 236
gi 118380705 162 KLLHLSQTadpLIVRAVDVSLILYAEHDFNASTFAARVTVSTLADFYSGITTAIGTLRGPLHGGANEAVMQYLENIrsiE 241
gi 145523265 160 KLYHLKSEidpLVVKTFDVSLILYAEHDFAASTFAARVTVSTLSDFYSGITTAIGTLRGPLHGGANEAAMQYLEPLrsiQ 239
gi 57168401  163 EKLKLEAPk-eDFIKAMQCSLILYAEHEFNASTFTARICASTKSDIFSAVAAAIGALRGPLHGGANEAAMHLIESFksvE 241
gi 29654102  158 HLLLGKKAa-qMAIDCMNASLILYAEHEFNASTFAARVCSATLSDIYSAVTAAIATLRGPLHGGANEAAMDLIMLYktpS 236
gi 161075825 160 HLLYGHPAt-aDQIRALDVALILHAEHEFNASTFTCRVITSTLSDFYSAITGGICALRGPLHGGADEAAMEQISKFhsvE 238
gi 169189618 159 QLLHQTEPg-vQHAKALDVSLTLYAEHEFNASTFAARVTASTLSDFYSAIATGVGTLRGPLHGGANEAAMELIERYgnpD 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                      ########   #    #                                      # #  # #   
gi 2506292   254 EAEADIRKRVENKEVVIGFGHPVY-TIADPRHQVIKRVAKQLsq---egGSLKMYNIADRLETVMWES-KKMFPNLDWFS 328
gi 77165673  239 EAEQGVLAALENKEKIMGFGHRVY-KEADPRNAIIKDWCRQLae---raGDSYLFPIAERIEVVMKRE-KGLFPNLDFYI 313
gi 32265897  247 EAEKGILDKLARKDKIMGFGHRVY-VKADPRNVVIKEWSKKLsed--vgDTKGLYPISEAIEKVMWEQ-KKLFPNLDFYS 322
gi 108805204 237 EAERGLREALSRGERLMGFGHPVY-TRVDPRSDIIKGWSRRLse---ghEEGYLYEVSERIERILHEE-KNLFPNLDFYS 311
gi 118380705 242 EANSFLTESFKSKKLIMGFGHRVY-KNGDPRSDIIKEYSKLLaekqpkfGKKILYQISEHIETRVVNE-KKKFPNLDFYS 319
gi 145523265 240 QADQFLNSRYQSKQLIMGFGHRVY-KKEDPRSPIIKDFSLQLskt--anGDPTLLAVSQHIEKRMIEE-KKIYPNLDFYS 315
gi 57168401  242 DAIEGVNKKLENKELLMGFGHRVYgLGGDPRNALIKVWSKHLg------GDDLLFKISEAIEALMKEKrPSLPPNADFYS 315
gi 29654102  237 EAIAGIKRKLANKELIMGFGHAVY-RERDPRNAIIKSWAQKLap---naADGYLFDISDAIENTMQDE-KKLFPNLDFYS 311
gi 161075825 239 EAEEGIKAMLSKKEKVMGFGHRVY-KYGDPRSEIIKQWAKNLss---ktGSQVLFSIAEKIEEVMFKE-KHLYPNVDFYS 313
gi 169189618 238 DAEAGILEALRQKQLIMGFGHRVY-SVSDPRSDVIKEWSLALse---qaGDRKLYEISERIEQVMRRE-KKLFPNLDFYS 312
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*..
Feature 1                         #   #               #  #                
gi 2506292   329 AVSYNMMGVPTEMFTPLFVIARVTGWAAHIIEQRQDNKIIRPSANYVGPEDRPFVAL 385
gi 77165673  314 APAYRFLGIPVHLYTPLFVCSRVAGWAAHIMEQRADNRLIRPMANYIGPEPRDFVPI 370
gi 32265897  323 ASAYHFMGIPTPYFTPIFIFSRTAGWLAHIFEQRANNKLIRPSSEYIGPDKKAFVPL 379
gi 108805204 312 ASAYRFCGIPTEMFTPLFVFSRTSGWTAHVIEQRESGKIIRPSANYTGPERRPFVPL 368
gi 118380705 320 ASTYHQCGIPTELFTPIFVMSRVTGWAAHIFEQRANNKLIRPTSNYTGPQKLSFVPL 376
gi 145523265 316 ASAYKQCGVPTPMFTAIFVISRMTGWGGHLIEQRSNNKLMRPVSDYTGPAKKQFVPI 372
gi 57168401  316 ASAYHFMGIPTEYFTPIFIMSRVSGWCAHIKEQRANNKLIRPSSEYIGVEPRKFVKI 372
gi 29654102  312 ATAYHFLNIPTKLFTPIFVMSRVTGWCAHIFEQRKDNRIIRPNADYIGPEEQGWVPI 368
gi 161075825 314 ALTYHFLGIPTLLFTPLFVISRTAGWCAHIFEQRANNRLIRPIAEYVGPLPMPYIPI 370
gi 169189618 313 ASAYYHLGIPTPLFTPVFVLSRLTGWSAHVMEQRAGNRIIRPSADYIGPDPQEWLPL 369

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap