Conserved Protein Domain Family
BsCS-I_like

?
cd06109: BsCS-I_like 
Click on image for an interactive view with Cn3D
Bacillus subtilis (Bs) citrate synthase CS-I_like. CS catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). 2MCS catalyzes the condensation of propionyl-coenzyme A (PrCoA) and OAA to form 2-methylcitrate and coenzyme A (CoA) during propionate metabolism. The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA. This group contains proteins similar to BsCS-I, one of two CS isozymes in the gram-positive B. subtilis. The majority of CS activity in B. subtilis is provided by the other isozyme, BsCS-II (not included in this group). BsCS-I has a lower catalytic activity than BsCS-II, and has a Glu in place of a key catalytic Asp residue. This change is conserved in other members of this group. For E. coli CS (not included in this group), site directed mutagenesis of the key Asp residue to a Glu converts the enzyme into citryl-CoA lyase which cleaves citryl-CoA to AcCoA and OAA. A null mutation in the gene encoding BsCS-I (citA) had little effect on B. subtilis CS activity or on sporulation. However, disruption of the citA gene in a strain null for the gene encoding BsCS-II resulted in a sporulation deficiency, a characteristic of strains defective in the Krebs cycle. This group contains proteins which functions exclusively as either a CS or a 2MCS, as well as those with relaxed specificity which have dual functions as both a CS and a 2MCS. Many of the gram-negative species represented in this group have a second CS isozyme which is in another group.
Statistics
?
PSSM-Id: 99862
View PSSM: cd06109
Aligned: 16 rows
Threshold Bit Score: 440.589
Threshold Setting Gi: 8894738
Created: 18-Oct-2007
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 26 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1           #                                                                            
2C6X_A         3 YGLKGITCVETSISHIDGekGRLIYRGHHAKDIALNHsFEEAAYLILFGKLP--STEELQVFKDKLAAE-RNLPEHIERL 79
gi 21224176   17 RGLAGVVVADTEVGDVRGleGFYHYRQYSAVELARSRgFEDVWHLLVHGELP--DARTGAAFAAETAAL-RRLPDAVRAA 93
gi 108766592  25 PGLEGVVATRTRLSMVDGaaGRLVIAGFPVEELAGRAsFEETLYLLWNGVLP--DAGRLEGLRGDLAAR-RALPEAAGEV 101
gi 89099680   14 KGLKGILAAETSVGHVDGlkGQLIYRGYEIGELTRKCsFEEAAFLLWHGRLP--ARGELDDLKTELHSF-RAIPPHVASI 90
gi 56965801    5 KGLENVVVAETTISAIDGeqGTLLYRGYQAEELAKSAdFEDVAYLLLNGQRP--TEAEKDDFSTALKTM-RPLPDDLKKL 81
gi 154251313  18 SGLDNVVAAETMLSHVDGeaGRLIVAGYEVEDLVKAHdFEGAAAALWNAAGLe-NAPSEEAVRRDLGRArEAAFALVPGL 96
gi 27375294   10 IGLDGVPAAETVLSHVDGerGELIIAGEHVGRLAAKSsFEGVTARLWNGASK--TSLSEANVRASLGAArERAFARLAEL 87
gi 159900659   9 VGLEGIVAAATRLSSVDGqaGELIIAGFPLERLAPFAtFEETIFLLWNDHLP--SQSELAELRQSLASQ-RQLPALTLEV 85
gi 118591515  34 AGLEGVVAATTMLSHVDGqeGVLVLYGRHIEDLAGKLsFEDAVRHLWQDFDLpeASGLREAFGKARRAA-FAVMPVLEAA 112
gi 114797906   3 SGLENIVAAETVLSDVDGqnGRLVIRGWPVELLSASMaFEDTAHLLWEGFFE--DLRDVSSLGRQLGEArEAAFAIVSGI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
2C6X_A        80 Iqsl---pnnMDDMSVLRTVVSALgenty-------tfhpkTEEAIRLIAITPSIIAYRKRWTRGEQAIAPSSQyGHVEN 149
gi 21224176   94 LpaiaeagagSGPLAGMRTGLSLLgaalgfrpvydlsvdqrRQDTLVAAAAVPTLLTALHRLGRGLEPVEPREDlSYAAN 173
gi 108766592 102 Leaav--aggAAPIDALRMAAGTLaps-----------gndRDDALTSVAAFPTIVAACWRLSQGREPVEPDPGlSHAAN 168
gi 89099680   91 Itam---pvsFSMMDVLRTAVSSLggsl---------ekpaVRQAVQLTALIPVMIAFRSRLLEGKQPVDPEPSlGHAAN 158
gi 56965801   82 Laal---pkdLSMMDALRTLISSYtgkeg--------wppqQQEAMRLVAIVPTIVAAWANRSCGKDAIEPDPSlNHVAN 150
gi 154251313  97 Lsln----chETVTEGLRTGLSMLsdepae------gpakdIPAHIRALGAAAVFTAALCRAREKKSPVAPDARsGHAED 166
gi 27375294   88 Lpat----hgMGIVDGFRAAVAGLrae------------hgLEHEATIVGAFPVISGALVRRAKGLDPVAPDPSaSHAAD 151
gi 159900659  86 Aqqlg--reqADPMDALRAATATLnpl-----------adeKATAQRIVAALPTIVAAYWRARNQAEFIEPRSDlSHAAN 152
gi 118591515 113 Ps-------sLSVYERMQLGLAALpls------------tgLPDAIAISGALPVFLAASHRIATGQSPIAPDSTlETATD 173
gi 114797906  81 Pd-------gLDSVSFLRAGWALLpdd------------esLETAIRLAGSAPVLTAAAIRRGRGEPPIAPNAQlSQSAD 141
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                   #  #                              ### #  #           
2C6X_A       150 YYYMLtGEQPseAKKKALETYMILATEHGMNASTFSARVTLSTESDLVSAVTAALGTMKGPLHGGAPSAVTKMLEDIgek 229
gi 21224176  174 YLYMLtGQEPdeACTRAIEQYLISTIDHGFNASTFTARVIASTGADVAACLAGAVSALSGPLHGGAPSRALDTLDAIgtp 253
gi 108766592 169 YLYMLsGEVPgeERVRALETYLNTVSDHGMNASTFAARVISSTGSDLISAVVGAIGALKGPLHGGAPGPALDVVFEIgep 248
gi 89099680  159 YLYMLkGQIPekAHSEALETYLLLTMEHGMNASTFSARVTASTESDLISAITSAIGTMKGPLHGGAPSGVIELLDEImer 238
gi 56965801  151 YLYMLtGEKPhaAHIRALSAYLILTAEHGMNASTFAARVIASTEADLRSAICGALGALKGRLHGGAPTGVLELFSDIqta 230
gi 154251313 167 FLRMLrGEAAsaAEVEALNAYLVTVADHGMNASTFTARVIASTRAGTISAVVGALCALKGPLHGGAPGPVLDMLDDIgtr 246
gi 27375294  152 TLRMLhGRAPatREVTALDAYLVTVCDHGMNASTFTTRVVASTQADLFAAVTAGYCALTGPLHGGAPEPVLEMLDAIgsr 231
gi 159900659 153 YLWMLtGKEPsaEKVRALETYLNTVVDHGLNASTFTTRVIISTESDLVSAITGAIGALKGPLHGGAPGPALDMVFEIgta 232
gi 118591515 174 LLRMLsGELPpaAHAAALNRYLVTILDHGLNASTFTARVIGSTQANLKQAVLGAMGALSGPLHGGAPGPVLDMIDAIgrp 253
gi 114797906 142 FLHMLtGKVPhqAEARALDAYLVTVCDHGLNASTFAARVVASTRAGLTSAAIAGISALKGPLHGGAPGPVLDMLDAIgvp 221
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                        ########  #    #                                         # #  # 
2C6X_A       230 -ehaEAYLKEKLEKGERLMGFGHRVYKTKDPRAEALRQKAEEVagnd---rdldLALHVEAEAIRLLEIYKPgRKLYTNV 305
gi 21224176  254 -driDAWIRERVLAGDRIMGFGHAVYRTEDPRSRMLREVAQSFggp-----rveFAVEVERQVEAILAELKPgRELHTNV 327
gi 108766592 249 -graEGVLRERLDRGERLMGFGHRVYKVRDPRADVLAGAAERLyasdadeelyrLALEVERTALRLLEEYKPgRNLDTNV 327
gi 89099680  239 -gdaEAVIREKLERGEKLMGFGHRIYKTLDPRAAALKDKLQQFaghd---twldMALVTEQTALRLLGEYKPgRSLYTNV 314
gi 56965801  231 dtssETLLREKLERGERLMGFGHRVYKTTDPRANALREVLKSLnnqe---tflsEAVAIEQLATQLLAEYKPgRQLHANV 307
gi 154251313 247 -eniEPWLAREIAKGERLMGFGHRVYRVRDPRADVFNKAVTILtngn---ervlFARDVEVAALAALRKAKPgNRIDTNM 322
gi 27375294  232 -eriQPWVDAALARGERMMGFGHRVYRVRDPRADVLKTAIEALasng---adlpFAGEVEAYIRAALRKKNPdRPLETNV 307
gi 159900659 233 -draEEVLRAKLARGERLMGFGHRVYKVRDPRAEVLAGAADQLfandgnrelyeLVRHVEQTAIRLLEEHKPgRKLQTNV 311
gi 118591515 254 -enaAAWIGGALARGERLMGFGHRIYRTRDPRADVLKAGLRLLgadn---pkvrLAEEIEQAALAALKAAKPdRPLETNV 329
gi 114797906 222 -enaERWIDEALARNERLMGFGHRVYRVRDPRADALKTALARLpgts---grigFAEHIERAVLGRLAEKYPrRTLETNV 297
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|..
Feature 1        #                    #   #               #  #       
2C6X_A       306 EFYAAAVMRAIDFDDELFTPTFSASRMVGWCAHVLEQAENNMIFRPSAQYTG 357
gi 21224176  328 EFYAGVVMELCGLPREMFTPTFAAARVVGWSANILEQASDSKIIRPAARYVG 379
gi 108766592 328 EFYTALLLHGLGLPTGLFTPTFAVGRVAGWTAHCLEQRETGRLIRPQSEYVG 379
gi 89099680  315 EYYAAAIMKALKMDSSLFTPTFTAARIAGWTAHVIEQADNNAIFRPESLYIG 366
gi 56965801  308 EYYAAAIMEALRLKPDWFTPTFCVSRVVGWCSHVIEQSQDNRIMRPQQQYCG 359
gi 154251313 323 EYYTAVLLEALGIPREAVTSVFAMSRIAGWTAHVMEQERVGRLIRPQSKYVG 374
gi 27375294  308 EFFTAILLDALAIPRQAFTPIFAVARAAGWTAHAREQQRTGRLIRPSSSYVG 359
gi 159900659 312 EFYTALLLHGIDFETDLFTPTFTISRAVGWIAHAFEQRAVGRIIRPQSIYTG 363
gi 118591515 330 EFYTAVLLDAIGIDRILFTPLFAVGRTPGWCAHVLEQQETGKLIRPSSHYVG 381
gi 114797906 298 EFYTALLLEALGLPREAFTAVFACGRIIGWTAHAREQIGEGRLVRPRSVYRG 349

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap