Conserved Protein Domain Family
citrate_synt_like_1_1

?
cd06112: citrate_synt_like_1_1 
Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the oxidative citric acid cycle (TCA or Krebs cycle). Peroxisomal CS is involved in the glyoxylate cycle. This group also includes CS proteins which functions as a 2-methylcitrate synthase (2MCS). 2MCS catalyzes the condensation of propionyl-CoA (PrCoA) and OAA to form 2-methylcitrate and CoA during propionate metabolism. This group contains proteins which functions exclusively as either a CS or a 2MCS, as well as those with relaxed specificity which have dual functions as both a CS and a 2MCS. The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA. There are two types of CSs: type I CS and type II CSs. Type I CSs are found in eukarya, gram-positive bacteria, archaea, and in some gram-negative bacteria and are homodimers with both subunits participating in the active site. Type II CSs are unique to gram-negative bacteria and are homohexamers of identical subunits (approximated as a trimer of dimers). Some type II CSs are strongly and specifically inhibited by NADH through an allosteric mechanism.
Statistics
?
PSSM-Id: 99865
View PSSM: cd06112
Aligned: 8 rows
Threshold Bit Score: 689.16
Threshold Setting Gi: 177660411
Created: 5-Nov-2007
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
  next features
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1             #                                                                          
gi 78484695    3 YIPGLAGVPATESEISYIDGnkgVLTYRGYDIMELAEYSsFEETTLLLLFGNLPTADELADFENKLRNARRVKYNLREIM 82
gi 118603023   4 YIPGLAGVPATESSISYIDGkngILTYRGYSIEDLVKYGsFEEVSMLLRDGELPDKNKLDNFKNILHKRYEVKRNIRSMM 83
gi 114778674  15 YSPGLAGIPAAESSISYVDGqhgYLEYRGIDIEQLAEHSsFEETAWLLLYGTLPTADELAAFDKELRHHRRVKFRIRDMM 94
gi 2493723    11 FKEGLAGVPAAKSRVSHVDGtdgILEYRGIRIEELAKSSsFIEVAYLLIWGKLPTQAEIEEFEYEIRTHRRIKYHIRDMM 90
gi 1705885     6 FAPGLEGVAATQSSISNIDGaagLLSYRGFAIADLAAHSsFEEVALLLLDGVLPGAADLERFDHGLRAHRQVKYNVREIM 85
gi 77166086    4 YLPGLEGVPATQSNISDVDGergILSYRGYPIEDLAERStFEETTLLLLDGELPTAQRLEEFTQELRQNYRVKYNIRTLM 83
gi 168700149   7 YKPGLEDVPAAKSAVSFLDGkkaVLEYRGIPVEVLAKESsFEEVSWLLVKGDLPTQKQLAEFDHDLRQRRAIHFRLKDLI 86
gi 177660411   3 IIPGLADVPVAYTKICLLDGkngKLIYRGYDVEELFEKSkYLETVYLLIFGDLPSKAEYENFKKDIKLHSRLKFRIIDVM 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 78484695   83 KNLPATTHPMHMLQVAVASLASFYpsteymkg--gtenqeyiNEVTVNIISHMGTLVAMWEHMRNGFDPIEPRKDLTYAE 160
gi 118603023  84 WSLPANGHPMNVLQTTIAAMATFYpdagaqn-----pdsvytQGALTKIISNMSTLVAMWARISAGYDPIPPSRGMSYAK 158
gi 114778674  95 KCFPESAHPMDSLQATVAALGMYYpfpksekg---rldpktaHQVCVNLIAKMPTLVAAHARMRHGDDPIAPRDDLSHAA 171
gi 2493723    91 KCFPETGHPMDALQTSAAALGLFYarrald-------dpkyiRAAVVRLLAKIPTMVAAFHMIREGNDPIQPNDKLDYAS 163
gi 1705885    86 KFMPVTGHPMDMLHCAVASLGMFYpqqelsda--ergntlhlDAMAMRIIARMPTIVAMWEQMRFGNDPISPRPDLSHAA 163
gi 77166086   84 TALPSTGSPMEMLQAGVSALGMFYpgnecltdsdsctdrdyvDNMTVKIIARMPALVAMWEHIRNGYDPIPPRPDLPIAD 163
gi 168700149  87 KCMPADGHPMDALHAGVAALGMFYpcptvs-------npaknWDATCRLIAALPTLVAAFARVRRGEEILDPRSDLDHAG 159
gi 177660411  83 KNFPEKAHPIEVLQSVVSCLGMFYkkenvl-------nedyqYLSIVKLLAKIPLIIANWNRIRNGDNPLEPNPDFDYVE 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                    #  #                              ### #  #          
gi 78484695  161 NFLYMvtGEEPdkDWARLLDACLILHAEHTINASTFTTMVTGSTLANPCSVISSAIASLSGPLHGGANQKVIEMLDEIGt 240
gi 118603023 159 NFLYMsfGEEPddDIVKLFDACLILHAEHTINASTFSAMVTASTLANPFASISAAVGTLAGSLHGGANEDVLKMLDEIGd 238
gi 114778674 172 NFFYMltGEEPypLTERIMDVALIVHAEHTMNASTFSTLVVASTHADPYSSISAAIGALAGPLHGGANEDVLHMLDEIGs 251
gi 2493723   164 NFLYMltEKEPdpFAAKVFDVCLTLHAEHTMNASTFSARVTASTLTDPYAVVASAVGTLAGPLHGGANEEVLNMLEEIGs 243
gi 1705885   164 NFLYMlsGREPdpAHTKILDSCLILHAEHTINASTFSVLVTGSTLTNPYHVIGGAIGTLAGPLHGGANQKVVEMLEEISs 243
gi 77166086  164 NLLYMfyGEEPdpLLAKIMDTCLILHAEHTTNASTFATLVTASTLASPYAVISGAVGTLSGPLHGGANERVVEMLREIGr 243
gi 168700149 160 NFYYMlfGKEPspATRKVLDACLILHAEHQMNASTFTARVTGSTLATPYHTIASAIGSLSGPLHGGANEEALRQFEEIGg 239
gi 177660411 156 NFLYMyfGQKPtkEKVEILEKCLILHAEHSMNASTFAAIVVGSTLADPFTVISSAIGALSGPLHGGANEDVIKMFKEIEs 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                          ########  #    #                                         # #  
gi 78484695  241 penARPYIEKRLAE--KKVIWGMGHREYKTKDPRATILQKLSSELlqnksdagslskaFETAMEVERVCEELLGHKGVYP 318
gi 118603023 239 aknARAYIKNRLKN--KQIIWGMGHREYSVKDPRASILQSMIEDYvkksnm--hfskrFETALEVERICEDLLSSKGVYP 314
gi 114778674 252 veaADAYLNNKLSK--KEKISGLGHRVYKTKDPRATLLQKLYVELtekmg----sdptYEIARHIEELSKSTLGSKGVCP 325
gi 2493723   244 venVRPYVEKCLAN--KQRIMGFGHRVYKVKDPRAIILQDLAEQLfakmg----hdeyYEIAVELEKVVEEYVGQKGIYP 317
gi 1705885   244 vqqVGAYLDRKMAN--KEKIWGFGHRIYKTRDPRAVILKGMMEDMashgnl--rhsslFEIAIEVERQATERLGAQGIHA 319
gi 77166086  244 penVKTWLDKQLDR--KQIIWGFGHRVYKVKDPRAKILQKLMERLpaergg--qlsplFETAIALEEAATERLGHKGIYA 319
gi 168700149 240 peqVKGWLDAKRAVdsKYKVMGMGHRVYKVKDARATVLQEIAEHMfaeta----rpktYETALELERLCAGIYGPKGIYP 315
gi 177660411 236 lqnVKKYIDEKLES--KKKIPGFGHRIYKTYDPRAKLLKKILENLeikde---elrnlYSIAQEVEKYVLEKLSHKGVYP 310
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
Feature 1        # #                     #   #               #  #                
gi 78484695  319 NVDFYSGILYKEMGFD-AGLFTPIFAVARSAGWMAHWREQLQNNKIFRPTQIYTGAGNSCYLPM 381
gi 118603023 315 NVDFYSGILYAEIFKIpQTHFTPIFAMARSAGWTAHWHEQVGHNRIFRPAQIYIGSNFRNYSKK 378
gi 114778674 326 NVDFYSGIVYRKLGIA-TDLFTPIFAVSRVAGWLAHWKEQLGDGRLYRPNQIYRGLRDQTYVPI 388
gi 2493723   318 NVDFYSGLVYRKLDIP-ADLFTPLFAIARVAGWLAHWKEQLSVNKIYRPTQIYIGDHNLSYVPM 380
gi 1705885   320 NVDFYSGVLYHEMGIK-ADLFTPIFAMARSAGWLAHWREQLADNRIFRPTQVYTGEQDRRYVPV 382
gi 77166086  320 NVDFYSGILYMELGIP-IDQFTPLFAVSRSAGWLAHWHEQLSDNRIFRPTQVYVGEPLRRYVPL 382
gi 168700149 316 NVDFYSGVVYQSLGIP-TDVFTPIFAIARVSGWLAHWTEQLVGNRIFRPEQISIGKTDVKYVPL 378
gi 177660411 311 NVDFYSGLVYKYLGFG-EDMYTSLFALARVSGWLAHWKEYITDNKLIRPTEIYIGEIDKKYNDR 373

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap