Conserved Protein Domain Family
AthCS_per_like

?
cd06115: AthCS_per_like 
Arabidopsis thaliana (Ath) peroxisomal (Per) CS_like. CS catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA. This group contains three Arabidopsis peroxisomal CS proteins, CYS1, -2, and -3 which are involved in the glyoxylate cycle. AthCYS1, in addition to a peroxisomal targeting sequence, has a predicted secretory signal peptide; it may be targeted to both the secretory pathway and the peroxisomes and is thought to be located in the extracellular matrix. AthCSY1 is expressed only in siliques and specifically in developing seeds. AthCSY2 and 3 are active during seed germination and seedling development and are thought to participate in the beta-oxidation of fatty acids.
Statistics
?
PSSM-Id: 99868
View PSSM: cd06115
Aligned: 7 rows
Threshold Bit Score: 745.802
Threshold Setting Gi: 46110941
Created: 9-Nov-2007
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
  next features
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                               #                                        
gi 15231130   71 EHGTVKavDLKKITTGkd--------dkGLKLY--DPGYLNTAPVRSSICYIDGDeGILRYRGYPIEELAESStFIEVAY 140
gi 73917790   66 DDGTVKavDFKKIVTGke--------dkGLKLY--DPGYLNTAPVRSSISYIDGDeGILRYRGYPIEEMAENStFLEVAY 135
gi 168002102  59 EGGTVKatDFKKITAGed--------gnGLRLF--DPGYLNTAPVRSKISYIDGDkGILRYRGYPIEELAEKSsFTEVAF 128
gi 66818329   36 HETVKSi-DFRAIKEQsi--------dfGTMIY--DPGYYNTAVCKSQITYIDGDrGILEYRGYPIEQLAEKSsFLEVSY 104
gi 39930179   39 NSREGRyiMAKDIGKIkd--------aeGNVLRvyDPGYMNTIVNTSRICYIDGDlGVLEYRGIPIEQLAEKStFLEVAY 110
gi 158275582  55 DGGTINaqALKQIKAGgd--------gvGLRTY--DPGYTNTTAVISRISFIDGDkGILRYRGYPIEELAARSnMMEVAY 124
gi 46110941   29 THNSIPatEFKKIKAEagndrpedetnqGLRVY--DPAYMNTAVVQSKITYINGLdGVLRYRGYPIEQLVEKSdFLESAY 106
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 15231130  141 LLMYGNLPSQSQLADWEFTVSQHsaVPQGVLDIIQSMPHDAHPMGVLVSAMSALSIFHPDANPALSGQDIYKsk------ 214
gi 73917790  136 LLMYGNLPSESQLSDWEFAVSQHsaVPQGVLDIIQSMPHDAHPMGVLVSAMSALSIFHPDANPALRGQDIYDsk------ 209
gi 168002102 129 LLMYGNLPTKSQLADWEASISQHsaVPEGVLEVLAALPHDAHPMGMLVGSICALSSFHPDANPALQGQDLYKnk------ 202
gi 66818329  105 LLIYGDLPSKEQSNLWNTKIMNHtfIHENLISMMKSFRYDAHPMGMLISSLSAMSTFYPEANPALAGVDIYKnk------ 178
gi 39930179  111 LLIYGELPTKTQFEEFNQRISGHtfLHTDVLQMMKHFRYDAHPMGMLISTIAALSTFRPGSNPALAGQDIYKdl------ 184
gi 158275582 125 LVLYGSLPTQSQLSVFHEAVMRHtaLPTEVIDVIHAMPHDSHPMGVLMTGICALSAMHPEANPALAGQGVYKtr------ 198
gi 46110941  107 LLIYGELPTKSEYDLWHGEVMHHtyIHSDIENMFKSFRYDSHPMSMLTAAFATLGAFAPEANPSLAGQKLYTnaasgnle 186
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                    #  #
gi 15231130  215 --qVRDKQIVRILGKAPTIAAAAYLRTAGRPPVLPSANLSYSENFLYMLDsmgnrsYKPNPRLARVLDILFILHAEHEMN 292
gi 73917790  210 --qVRDKQIIRIIGKAPTIAAAAYLRMAGRPPVLPSGNLPYADNFLYMLDslgnrsYKPNPRLARVLDILFILHAEHEMN 287
gi 168002102 203 --aVRDKQIVRVLGKVPTLAAAAYLRMAGRPPVLPSNQLSYAENFLYMLDslgdrkYKPNPRLARVLDILFILHAEHEMN 280
gi 66818329  179 --qLMNKQIFRILGKLPTIAACAYRHRIGRPYNDPSNTLSYTENFLYMLDrlsesnYKPHPVLTRALDKLFIIHADHELN 256
gi 39930179  185 --kIRNKQIYRILGQVPTIAANAYRSRIGRNFNNPSSDLPYVDNFLYMMDklnenkYSPHPKLAKALDILFILHAEHEMN 262
gi 158275582 199 --eMQDKQIVRLLGKIPTIAAMAYHKSTGRKAAPPNQRLDYTENFLYMLDggynpqYRPNPRLARALDIMFLLHAEHEMN 276
gi 46110941  187 alqMLDKQILRILGKAPTLAAASYRMRQGRPFNRPAQDLGYTGNFLYLLDhlsetdYKPHPVLARALDKLFIIHADHEVN 266
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                      ### #  #                           ########  #    
gi 15231130  293 CSTAAARHLASSGVDVYTACAGAVGALYGPLHGGANEAVLKMLAEIGTAENIPDFIEGVKNRKR-KMSGFGHRVYKNYDP 371
gi 73917790  288 CSTAAARHLASSGVDVYTAVAGAVGALYGPLHGGANEAVLKMLSEIGTVENIPEFIEGVKNRKR-KMSGFGHRVYKNYDP 366
gi 168002102 281 CSTAAARHLASSGVDVYTALAGATGALYGPLHGGANEAVLKMLAEIGTVENIPDFLEGVKNSRKrKMSGFGHRVYKNYDP 360
gi 66818329  257 CSTATMRQIASTLVDPYTACAGSAGALYGPLHGGANEAVLRMLEAIGTIENIPKFIEQVKQKKQ-RLMGFGHRVYKSYDP 335
gi 39930179  263 CSTAFVRHLASSGVDVYSCIAGSAAALYGPKHGGANEAVLRMLEQIGDVKNIPSFIDKVKNRKA-LLFGFGHRVYKNYDP 341
gi 158275582 277 CSTAAVRHLASSGVDVYTAVAGAVGALYGPLHGGANEAVLRMLARIGSVENIPAFIAGVKNKKE-KLFGFGHRVYRNFDP 355
gi 46110941  267 CSTATVMQVGSSLVDPYSVVAAGCAALYGPSHGGASESAIRMLIEIGSPENVPAFMQAVEKRER-VLVGFGHRVYKNVDP 345
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #                                        # #  # #                    #   #      
gi 15231130  372 RAKVIKKLADEVFs-IVGRdPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRAMGfppeFFTVLFAVPRMAGYLS 450
gi 73917790  367 RAKVIKNLADEVFs-IVGKdPLIEVAVALEKAALSDDYFVKRKLYPNVDFYSGLIYRAMGfppeFFTVLFAIPRMAGYLS 445
gi 168002102 361 RAKVVRTLADEVFk-IVGRdPLIEVAVALEKAALADEYFVKRKLYPNVDFYSGVIYRALGfpteFFPVLFAIPRMAGYLA 439
gi 66818329  336 RAKILKTVTMEIFa-LLGKnPLMQIATELERLALSDSYFIERQLYPNVDFYSGIIYKSMGfptdMFPVLFSIPRAAGWLA 414
gi 39930179  342 RAKIVKKTAYEVFe-ICGKePLIEIAIELEKIALEDEFFIKRKLYPNVDFYSGVIYRAMGfptdMFPVLFTIPRVAGWLA 420
gi 158275582 356 RAKIIKDVAENEVfpLVGVdPLIEIAKALQDAALSDEYFVSRKLYPNVDFYSGLVYRALGfppqFFTVLFAIPRIVGYCA 435
gi 46110941  346 RSTAIRKLAEEVFe-VTGRnKLLDTALTLADYARKSEFMRSRNLYPNVDFYSGLIYQAMGfpldFYPVLFAVPRCVGWLA 424
                        410       420       430
                 ....*....|....*....|....*....|.
Feature 1                    #  #               
gi 15231130  451 HWRESLDDp-dTRIMRPQQAYTGvWMRHYEP 480
gi 73917790  446 HWKESLDDp-dTKIMRPQQVYTGvWLRHYTP 475
gi 168002102 440 HWKESLDDp-dTKIMRPQQWYQGeWLRHYTP 469
gi 66818329  415 HWVEELADp-eLRIFRPRQIYMGrRNMNYVP 444
gi 39930179  421 HWVEYLDDk-eNNIVRPRQNYVGyAKRDYVP 450
gi 158275582 436 HWRESLTDp-dTKIIRPQQDYKGvWLRHYSD 465
gi 46110941  425 HWRQMMLNsagVKIWRPRQLYIGeGEREYVE 455

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap