Conserved Protein Domain Family
CaCS_like

?
cd06116: CaCS_like 
Chloroflexus aurantiacus (Ca) citrate synthase (CS)_like. CS catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). This group is similar to gram-negative Escherichia coli (Ec) CS (type II, gltA) and Arabidopsis thaliana (Ath) peroxisomal (Per) CS. However EcCS and AthPerCS are not found in this group. The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA. There are two types of CSs: type I CS and type II CSs. Type I CSs are found in eukarya, gram-positive bacteria, archaea, and in some gram-negative bacteria and are homodimers with both subunits participating in the active site. Type II CSs are unique to gram-negative bacteria and are homohexamers of identical subunits (approximated as a trimer of dimers). Some type II CSs are strongly and specifically inhibited by NADH through an allosteric mechanism. C. aurantiacus is a gram-negative thermophilic green gliding bacterium, its CS belonging to this group may be a type I CS; it is not inhibited by NADH or 2-oxoglutarate and is inhibited by ATP. Both gram-positive and gram-negative bacteria are found in this group.
Statistics
?
PSSM-Id: 99869
View PSSM: cd06116
Aligned: 4 rows
Threshold Bit Score: 736.638
Threshold Setting Gi: 163849332
Created: 28-Mar-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
  next features
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                 #                                                                      
gi 163849332  44 GLMSYDPAYLNTASCKSSITYIDGDKGILEYRGYPIEQLAEQSSYLEVAYLLLYGELPSKERLAWWEYRISRHLFLHNSL 123
gi 21674648   46 GLLGYDPAFLNTCSCKSTITFIDGDKGILRYRGYPIEQLAEKSSFLETAYLLIKGELPDKERLAVWTYNIRHHTMTHANL 125
gi 116620772  42 GLMTYDPAFMNTASCQSAITYLDGEKGILRYRGYPIEQLAEQCSFLEVAYLLLNGELPTAEQLEYWQCKVMRHTMTHENV 121
gi 108804512  58 GLMTYDPGYTNTASCRSAITYIDGERGILQHRGIPIEELCEHSTYLEVAYLLIHGHLPTEEELSQWVYDITHHTYVHENI 137
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 163849332 124 VELIQAFRYDAHPMGILISSVAAMSTLYPeAKNIHDpaVREKQIWRIIGQIPTIAAFAYRHRIGRPFNLPDSSLSYTANL 203
gi 21674648  126 TKFMDGFRYDAHPMGILVGTLGALSTFYPdAKNVGEeeSRKLQVRRLIGKMPTLAAMSFRHSLGFPYVLPDNDLSYAGNF 205
gi 116620772 122 KKFMDGFHYDAHPMGILISTVAALSTFYPeAKNVGDakCRHKQIVRLIGKMPTLAAYAYRHRLGLPYIAPDPELGYTKNY 201
gi 108804512 138 KSFMDGFRHDAHPMGILLASVGALSTFYPeASDIDDeeQRNMAAIRLIAKMPTIAAFAYRHSLGLPYVYPDNDLSYTGNF 217
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                       #  #                              ### #  #       
gi 163849332 204 LYMMDymnqreYEVNPVLAKALDVLFILHADHEQNCSTSVMRSVGSSHADPYNALAAAAAALYGPLHGGANEAVLRMLQQ 283
gi 21674648  206 LSMMFrmteknYKPNPVLEHALDVLFILHADHEQNCSTNAVRSVSSSMVDPYSAIAAGCAALYGPLHGGANEAVIHMLKQ 285
gi 116620772 202 MNMLWkrtepkYAANPVLARALEVLFILHADHEQNCSTSTMRAVGSSNADPFVTTSAAIAALSGPLHGGANEEVLRMLDE 281
gi 108804512 218 LSMLFkmaepkYEPDPRLEKALDVLFILHADHEQNASTSAVRTVGSTRADPYTAVAAGVAALYGPLHGGANVAVLKMLQR 297
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                           ########  #    #                                        # #  
gi 163849332 284 IGHPKNVPAFIERVKKGEMRLMGFGHRVYKNYDPRAKIIRKIAHEVFAATAa-nPLLDVAMELERTALEDEYFISRKLYP 362
gi 21674648  286 IGSVDKIPEFIKLVKSGEGRLMGFGHRVYKNYDPRARIIKKIAFDVFEETGr-nPLLDIAIELERIALEDDYFIQRKLYP 364
gi 116620772 282 IGKPENIPGFIEQVKEGKRKLMGFGHRVYKNYDPRARIIKQVAEEVFEVTGr-nPKIDIALELEKIALSDDYFIKRKLYP 360
gi 108804512 298 IGSVKNIPDFLETVKQGKERLMGFGHRVYKNYDPRARIIKSHVDEVLEATGkesPWLDIAVELEKRALDDEYFTSRKLYP 377
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
Feature 1        # #                    #   #                 #  #                
gi 163849332 363 NVDFYSGLIYQALRFPieYFPFLFAIPRASGWLAQWIEMLEDPeQKITRPRQVYVGpqrrdYVPI 427
gi 21674648  365 NVDFYSGLIYQAMGFPteMFPVLFAIGRTPGWLAQWIEHVKDPeQKIARPRQIYLGekcrdYVPI 429
gi 116620772 361 NVDFYSGIIYQAMGFTpdQFTVLFGIPRTVGWLAQWQEMQQDPdKKIARPRQVYTGederdFVPI 425
gi 108804512 378 NVDFYSGLIYEALGIPteAFTVMFAIPRTSGWIAQWMEMLRDPeLKIARPRQIYTGprdqhYVPM 442

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap