Conserved Protein Domain Family
Ec2MCS_like_1

?
cd06117: Ec2MCS_like_1 
Subgroup of Escherichia coli (Ec) 2-methylcitrate synthase (2MCS)_like. 2MCS catalyzes the condensation of propionyl-coenzyme A (PrCoA) and oxalacetate (OAA) to form 2-methylcitrate and coenzyme A (CoA) during propionate metabolism. Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) and OAA to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). This group contains proteins similar to the E. coli 2MCS, EcPrpC. EcPrpC is one of two CS isozymes in the gram-negative E. coli. EcPrpC is a dimeric (type I ) CS; it is induced during growth on propionate and prefers PrCoA as a substrate, but has a partial CS activity with AcCoA. This group also includes Salmonella typhimurium PrpC and Ralstonia eutropha (Re) 2-MCS1 which are also induced during growth on propionate, prefer PrCoA as substrate, but can also can use AcCoA. Re 2-MCS1 at a low rate can use butyryl-CoA and valeryl-CoA. A second Ralstonia eutropha 2MCS is also found in this group, Re 2-MCS2, which is induced on propionate. This group contains proteins which functions exclusively as either a CS or a 2MCS, as well as those with relaxed specificity which have dual functions as both a CS and a 2MCS.
Statistics
?
PSSM-Id: 99870
View PSSM: cd06117
Aligned: 8 rows
Threshold Bit Score: 758.226
Threshold Setting Gi: 170790376
Created: 8-Nov-2007
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
  next features
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1           #                                                                            
P31660        20 VALSGVPAGNTALCTVGKSGNDLHYRGYDILDLAKHCeFEEVAHLLIHGKLPTRDELAAYKTKLKALRGLPANVRTVLEA 99  Escherichia col...
NP_273479     16 VALSGVAAGNTALCTVGRTGNDLSYRGYDILDLAQKCeFEEVAHLLIHGHLPNKFELAAYKTKLKSMRGLPIRVIKVLES 95  Neisseria menin...
EDO69475      15 VALSGTAAGNTALCTVGRSGNDLHYRGYDIHDLATQStFEEVSHLLVHGVLPTASQLKAYKTKLKRLRGLPAIVTEALEL 94  Dehalococcoides...
ZP_01885672   16 VALSGVPAGNTALCSVGKSGNDLHYRGYNILDLAEKAeFEEVAYLLIYGALPTRSQLINYKTKLKSLRGLPNSVKNILQQ 95  Pedobacter sp. ...
YP_001489221  13 VALSGTAAGNTAICTVGKSGNDLHYRGYDILEFADKAeFEEIAYLIVHEKLPNKEELAAYKAKLKSYRDIPQGVKVALEQ 92  Arcobacter butz...
CAJ93007      16 VALSGVTAGNTALCTVGRTGNDLHYRGYDILDIAETCeFEEIAHLLVHGKLPTKSELAAYKAKLKSLRGLPANVKAALEW 95  Ralstonia eutro...
Q56063        20 VALSGVPAGNTALCTVGKSGNDLHYRGYDILDLAEHCeFEEVAHLLIHGKLPTRDELNAYKSKLKALRGLPANVRTVLEA 99  Salmonella typh...
EDT31420      13 VALSGVMAGNTALCTVGRSGNDLHYRGYDILDVAETCeFEEIAYLLVHGVLPTVAELDAYKAKLKAMRGLPAAVRQALEQ 92  Oligotropha car...
Feature 1                                                                                        
P31660       100 LPAASHPMDVMRTGVSALGCTLPEKEGHtvsgaRDIADKLLASLSSILLYWYHYSHNGERIQPETDDdSIGGHFLHLLHG 179 Escherichia col...
NP_273479     96 LPAHTHPMDVMRTGVSMLGCVHPERESHpeseaRDIADKLIASLGSILLYWYQYSHNGKRIEVESDEeTIGGHFLQLLHG 175 Neisseria menin...
EDO69475      95 VPANAHPMDVLRTGCSVLGTVLPEREGHpaseaRDIADRLIASFGSMLLYWWHFTRNGRRIDCETDDdSVAAHFLHLLHG 174 Dehalococcoides...
ZP_01885672   96 IPAAAHPMDVMRSTVSAIGSIQPERDDHnvsgaRDIADKLLACFSSALLYWYHYAHNGKTIEVETDDdSIGGHFLHLLHG 175 Pedobacter sp. ...
YP_001489221  93 LPKTCHPMDVMRTGCSVLGALNQEKEEHpkneaQDIIDRLMGSFSSILLYWYHFAYNGKRIDVVTDDdTVGGHFLHLLHG 172 Arcobacter butz...
CAJ93007      96 VPASAHPMDVMRTGVSVLGTVLPEKEDHntpgaRDIADRLMASLGSMLLYWYHYSHNGRRIEVETDDdSIGGHFLHLLHG 175 Ralstonia eutro...
Q56063       100 LPAASHPMDVMRTGVSALGCTLPEKEGHtvsgaRDIADKLLASLSSILLYWYHYSHNGERIQPETDDdSIGGHFLHLLHG 179 Salmonella typh...
EDT31420      93 LPAAAHPMDVMRTGVSVLGCVLPEAHDHnqpgaKDIADRLMASLGSMLLYWYHFSHNGRRIEVETDDdSIGAHFLHLLHG 172 Oligotropha car...
Feature 1                            #  #                              ### #  #                  
P31660       180 EKPsqSWEKAMHISLVLYAEHEFNASTFTSRVIAGTGSDMYSAIIGAIGALRGPKHGGANEVSLEIQQRYetpDEAEADI 259 Escherichia col...
NP_273479    176 KRPseSHIKAMHVSLILYAEHEFNASTFTARVIAGTGSDMYSSITGAIGALKGPKHGGANEVAYDIQKRYrnaDEAEADI 255 Neisseria menin...
EDO69475     175 EPPseLLADSLDKSLILYAEHEFNASTFTARVIAGTGSDLHSCITGAIGALRGPKHGGANEVAMDIISRYndaDEAEADI 254 Dehalococcoides...
ZP_01885672  176 RKPpeSWVKAMQISLNLYAEHEFNASTFTARVIAGTGSDIYSAITGAIGALRGPKHGGANEVAYDIQSRYgspEEAEADI 255 Pedobacter sp. ...
YP_001489221 173 EKPreSWVKAMHVSLILYAEHEFNASTFTSRVIAGTNSDMYSCITGSIGALRGPKHGGANEVAFRIQERYksaDEAEADI 252 Arcobacter butz...
CAJ93007     176 EKPsaLWERAMNTSLNLYAEHEFNASTFTARVIAGTGSDMYSSISGAIGALRGPKHGGANEVAFEIQKRYdnpDEAQADI 255 Ralstonia eutro...
Q56063       180 EKPtqSWEKAMHISLVLYAEHEFNASTFTSRVIAGTGSDVYSAIIGAIGALRGPKHGGANEVSLEIQQRYetpDEAEADI 259 Salmonella typh...
EDT31420     173 EKPssSHERAMHTSLILYAEHEFNASTFTARTIAGTGSDMYSAITGAIGALRGPKHGGANEVAFEIQQRYadaDAAEADI 252 Oligotropha car...
Feature 1                ########  #    #                                  # #  # #              
P31660       260 RKRVENKEVVIGFGHPVYTIADPRHQVIKRVAKQLsqegGSLKMYNIADRLETVMWESKKMFPNLDWFSAVSYNMMGVPT 339 Escherichia col...
NP_273479    256 RERIGRKEIVIGFGHPVYTISDPRNVVIKEVARGLsketGDMRLFDIAERLESVMWEEKKMFPNLDWFSAVSYQKLGVPT 335 Neisseria menin...
EDO69475     255 RARVERKEIVIGFGHPVYTVGDPRNPIIKEISRALckdgGNQTLFDVSERIENLMWDTKKMFPNLDWYSASAYHMMGIPT 334 Dehalococcoides...
ZP_01885672  256 HRRLENKEVIIGFGHPVYTISDPRNIVIKKVAGHLseeaGDMMLYTIADRLESLMWEEKKMFANLDWFSAVSYHLMGIPT 335 Pedobacter sp. ...
YP_001489221 253 RARMARKEIIIGFGHPVYSICDPRNVVIKKVAKDLsdenKNTLMYDVAERIETVMWNEKKMFPNLDWFSAVSYNQMGIPT 332 Arcobacter butz...
CAJ93007     256 TRRVENKEVVIGFGHPVYTTGDPRNQVIKEVAKKLskdaGSMKMFDIAERLETVMWDIKKMFPNLDWFSAVSYHMMGVPT 335 Ralstonia eutro...
Q56063       260 RKRVENKEVVIGFGHPVYTIADPRHQVIKRVAKQLseegGSLKMYHIADRLETVMWETKKMFPNLDWFSAVSYNMMGVPT 339 Salmonella typh...
EDT31420     253 RRRVEAKEVVIGFGHPVYTVADPRNEVIKDVARRLsaerGDMRMFEIADRIEAVMAETKKMFANLDWFSAASYYAMGVPT 332 Oligotropha car...
Feature 1              #   #               #  #                
P31660       340 EMFTPLFVIARVTGWAAHIIEQRQDNKIIRPSANYVGPEDRPFVAL 385 Escherichia coli K12
NP_273479    336 AMFTPLFVISRTTGWSAHVLEQRKDGKIIRPSANYTGPEDLAFVEI 381 Neisseria meningitidis MC58
EDO69475     335 PMFTPLFVIARTTGWSAHVIEQREDGKIIRPSANYTGPEDRQYVPI 380 Dehalococcoides sp. VS
ZP_01885672  336 LMFTPLFVISRVTGWSAHIIEQRQDGKIIRPSANYTGPENRDFVPM 381 Pedobacter sp. BAL39
YP_001489221 333 DMFTPIFIIARVTGWGAHVIEQREDGKIIRPSATYTGPEGLKFVPL 378 Arcobacter butzleri RM4018
CAJ93007     336 AMFTPLFVIARTSGWAAHIIEQRIDNKIIRPSANYTGPENLKFVPL 381 Ralstonia eutropha H16
Q56063       340 EMFTPLFVIARVTGWAAHIIEQRQDNKIIRPSANYTGPEDRPFVSI 385 Salmonella typhimurium
EDT31420     333 AMFTPLFVIARTSGWSAHIIEQRIDNKIIRPSANYVGPENLKFVPI 378 Oligotropha carboxidovorans OM5

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap