Conserved Protein Domain Family
RNaseT

?
cd06134: RNaseT 
Click on image for an interactive view with Cn3D
DEDDh 3'-5' exonuclease domain of RNase T
RNase T is a DEDDh-type DnaQ-like 3'-5' exoribonuclease E implicated in the 3' maturation of small stable RNAs and 23srRNA, and in the end turnover of tRNA. It contains three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. RNase T is related to the proofreading domain of DNA polymerase III. Despite its important role, RNase T is mainly found only in gammaproteobacteria. It is speculated that it might have originated from DNA polymerase III at the time the gamma division of proteobacteria diverged from other bacteria. RNase T is a homodimer with the catalytic residues of one monomer contacting a large basic patch on the other monomer to form a functional active site.
Statistics
?
PSSM-Id: 99837
View PSSM: cd06134
Aligned: 16 rows
Threshold Bit Score: 340.039
Threshold Setting Gi: 29654993
Created: 28-Feb-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 12 residues -Click on image for an interactive view with Cn3D
Feature 1:putative active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                  #### #                                                                
2F96_A        25 RFRGYLPVVVDVETGGFNSATDALLEIAATTVGXDEKGFLFPEHTYFFRIEPFEGANIEPAALEFTGIK-LDHPLRXAVQ 103
gi 24638163   21 RFRGYLPVVVDVETGGFDWNKHALLEIACVPIEMDAQGHFFPGETASAHLVPAPGLEIDPKSLEITGIV-LDHPFRFAKQ 99
gi 146328835   8 RFRGFLPVVVDVETGGFDHEKDALLEVAAVLVNFNEAGNLAPVETFHYHVKPFEGAHLNPDSLKINGID-PFHPLRPALD 86
gi 114773279  10 RFRHYFPVIIDVETAGFNAQTDALLEIAAVTVRMDEAGMLHPDQEIHYHINPFEGANIEPAAIEFNGIK-VDCALRGAVD 88
gi 153870628  12 RFRGFLPVVVDVETAGFNPERDALLEIAAVILQINEEGLWQPHQTHFSHIVPFEGANLDKQALEFIGVD-PFHPFRFAKQ 90
gi 53803894   11 RFRSYLPVVVDVETSGFDPHANALLEIAAVHLDMDESGNLHPVRTHQLHVKPFEGAKLDEAALNFNKIN-PFHPFRFAVD 89
gi 29654993   14 RFSGYLPVVVDIETGGLEPLKNPLLEIAAVLVEVNKEGQLCQGELFACHVLPFEGAALDPASLEITRID-PYHPFRFAVD 92
gi 78484942   10 RFRGFLPVVVDVETAGFDPQTNALIEIAIVTLKMNSDGTIERDQTVQANVLPFKGSQLDKSALKFIGVEdPTHPFRMAVS 89
gi 52843158   15 RFRGFLPVVVDVETAGIDPQKNALLEMCIVLLDMDEQGLLKKDSSYFEHILPFPGAELDQKSLEFNQID-PYQPLRFAVD 93
gi 90409038    8 RFRGYYPVIIDIETSGLNSQTDAILEIAAIFPAMDEQGYLYSAQTIHFNVQPFEGANMDPKALEFTGID-PFNPLRGAID 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                    ## ###                                              
2F96_A       104 EEAALTEIFRGIRKALKaNGCKRAILVGHNSSFDLGFLNAAVARTGIkRNPFHPFSSFDTATLAGLAYGQtVLAKACQAA 183
gi 24638163  100 EKDALDHVFAPVRAAVKkYGCQRAILVGHNAHFDLNFLNAAVARVGHkRNPFHPFSVFDTVTLAGVAYGQtVLARAAQAA 179
gi 146328835  87 EVTVAKQLFGAIREYQKaQSCTRSILVGHNAHFDLGFINALAARCNYqHNPFHPFSSLDTVSLGALAYGQtVLARIAKAA 166
gi 114773279  89 ETEAMKGLSKAISKLQKaANCQRSVIVAHNASFDMSFVNAALARTNVkRSPFHPFVSFDTTSLAALTLGQtVLVKACEAA 168
gi 153870628  91 EAEGLETVFKPIRKAVKiYGCTRAVLVGHNPSFDLSFINAASERTGV-KSPFHRFSTFDTATLAGLVYGQtVLARAVQAA 169
gi 53803894   90 EREALSQIFDAVQQSIRqHGCTRAILVGHNPAFDIAFLNAASSRARIkKNPFHPFSTFDTATLGGLAYGQtVLARAAQAA 169
gi 29654993   93 EKKALQDLFAFVEKAVNvAQCRRAVLVGHNAHFDLTFIQAAMKRCKLkKSPFHAFTCFDTATLAAIVFGKtVLAKALRAA 172
gi 78484942   90 EKDALEKCFAPIRQLLKeTDCSRAILVGHNAFFDLSFVKAAADRCKV-KSPFHEFSTFDTVSLAGLAYGQtVLAKAVQMA 168
gi 52843158   94 EQTALERLFKPIHDLLKkTRCQRAVLVGHNAWFDLLFIKAAIKRTGI-KSPFHAFTCFDTATLAGLIFGEtVLAKAAQAA 172
gi 90409038   87 EKEVLTEIFKLVRKHQKiNDCNRSILVAHNAAFDQGFINKASERCNFkRIPFHPFVCFDTASMAGLMLGQtVLAKACEQA 166
                        170       180       190
                 ....*....|....*....|....*....|
Feature 1                 #    #               
2F96_A       184 GXEFDNREAHSARYDTEKTAELFCGIVNRW 213
gi 24638163  180 GLDWNSADAHSAVYDTEQTARLFCKIANAW 209
gi 146328835 167 GFEYDSERAHGAKYDTELTAQIFCHIINTW 196
gi 114773279 169 NIAFDQKQAHGALYDAQRTAELFCFMMNRY 198
gi 153870628 170 GFEWNTSEAHAAIYDAQRTADLFCTIVNSW 199
gi 53803894  170 GLSWDHQEAHSAAYDANQTARLFCTIVNRW 199
gi 29654993  173 NLPFDKKEAHSAIYDAKCAAELFCKITNQI 202
gi 78484942  169 EIEWDNSKAHSAEYDTIKTADLFCKIVNQW 198
gi 52843158  173 GLHFDSQEAHSAIYDAEKTADLFCLMINKW 202
gi 90409038  167 NIDYNNEEAHSALYDTQVTADLFFYMVNKL 196

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap