Conserved Protein Domain Family
ISG20

?
cd06149: ISG20 
Click on image for an interactive view with Cn3D
DEDDh 3'-5' exonuclease domain of Interferon Stimulated Gene product of 20 kDa, and similar proteins
Interferon (IFN) Stimulated Gene product of 20 kDa (ISG20) is an IFN-induced antiviral exonuclease with a strong preference for single-stranded RNA and minor activity towards single-stranded DNA. It was also independently identified by its response to estrogen and was called HEM45 (human estrogen regulated transcript). ISG20 is a DEDDh-type DnaQ-like 3'-5' exonuclease containing three conserved sequence motifs termed ExoI, ExoII and ExoIII with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. ISG20 may be a major effector of innate immunity against pathogens including viruses, bacteria, and parasites. It is located in promyelocytic leukemia (PML) nuclear bodies, sites for oncogenic DNA viral transcription and replication. It may carry out its function by degrading viral RNAs as part of the IFN-regulated antiviral response.
Statistics
?
PSSM-Id: 99852
View PSSM: cd06149
Aligned: 7 rows
Threshold Bit Score: 276.626
Threshold Setting Gi: 58177183
Created: 28-Feb-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 14 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1           #### #                                     #   #                             
1WLJ_A         8 VAMDCEMVGLGPH-RESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARLEILQLLKGKLV 86
gi 42559527  180 VAIDCEMVGTGPKgHVSSLARCSIVNYNGDVLYDEYILPPCHIVDYRTRWSGIRKQHMVNATPFKIARGQILKILTGKIV 259
gi 112419022 196 VAIDCEMVGTGPNgRNSDLARCSIVNWFGDVMYDKYIKPKSPVTDYRTRWSGIRREHLVNATPFDVAQKEILKILSGKVV 275
gi 157073895 137 LALDCEMVGTGPKgAQSELARCSIVSYDGDVVYDKYVKPINPVTDYRTRWSGIRRQDLLHATPFYHAQKEIVKIITGKVV 216
gi 118102084 118 VAIDCEMVGTGPGgCTSSLARCSIVGYEGDVLYDSYVRPTEPIVDYRTRWSGIRKKHMVNAVPFCKAQREILKILSGKVV 197
gi 47214696    5 VALDCEMVGTGPGgRCSELARCSIVGYHGTVLYDKYVQPCQPVTDYRTPWSGIQRHHLQNATPFAQAREEILAALDGKVV 84
gi 68405191  136 VAMDCEMVGTGPGgRRSEVARCSIVDYYGNVVYDSYILPQDPVTDYRTRWSGIRSHHLRQAVPFEHAQNEILKILKGKII 215
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
Feature 1          ## ###                                                      #    #         
1WLJ_A        87 VGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLdhcrRVSLRVLSERLLHKSIQNSLLGHSSVEDARATMELYQ 163
gi 42559527  260 VGHAIHNDFKALQYFHPKSLTRDTSHIPPLNRKADCpenaTMSLKHLTKKLLNRDIQVGKSGHSSVEDAQATMELYK 336
gi 112419022 276 IGHAIHNDYKALNYFHPKEMTRDTSKIPLLNRRAGFpekeVASLKRLAKQLLHKDIQTGRQGHSSVEDAKTTMELYR 352
gi 157073895 217 VGHAIHNDFKALKYFHPAFQTRDTSRIPLLNEKAGFpekqCVSLKKLTQAILKRDIQTGYRGHSSVEDAKATMELYK 293
gi 118102084 198 VGHAVHNDFKALKYSHPKELTRDTSKIPLLNQKGGFpenvAISLKRLAKELLHKDIQVGKSGHCSVEDARTTMELYK 274
gi 47214696   85 IGHSVHNDFKVLDIAHPGHMVRDTSTSPLLSRLAGLs--cRRSLKVLSRRLLKRRIQGGRRGHNSVEDAQAALDLYK 159
gi 68405191  216 VGHALYHDLNVLYISVQPHMIRDTCSCVLLRQLYDAnqncNISLKKLAQKLLNRTIQVDRQGHCSVEDALSALDLYK 292

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap