Conserved Protein Domain Family
S2P-M50_PDZ_Arch

?
cd06159: S2P-M50_PDZ_Arch 
Uncharacterized Archaeal homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group appears to be limited to Archaeal S2P/M50s homologs with additional putative N-terminal transmembrane spanning regions, relative to the core protein, and either one or two PDZ domains present.
Statistics
?
PSSM-Id: 100080
View PSSM: cd06159
Aligned: 16 rows
Threshold Bit Score: 158.232
Threshold Setting Gi: 3024951
Created: 9-May-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
active siteputative
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 91772313    5 STLFALFLVYWAIVSILdkkgiferynistyGPVLMIRTv-KGQALLDTLArp---kRSWRTFanIGIVLMFVGMLAMFL 80
gi 74568974    5 QLLLVGLLAYWAAVSWAqsrgllp-sfvhtsGPITTLHTk-RGKRFLDWMAtp---kRLWRAWgnFGLGLASVVLVGVLI 79
gi 76801777    5 LWVLVGILLYTSVAMALksrgvlp-davsvsGPLLTVHTk-RGRAFLDWLAtp---kRLWRAWgnFGVGIALVIMVGSFL 79
gi 110667070   5 LWVLVGLAAYSAGTFFLsqrgllp-kfvqvqGPFTTIHTq-RGREFIEWIAqp---kRFWRAWtnFGVGTALVIMVGMFA 79
gi 15922403    5 EVFGISLIVFWGLMYLLrkkleg---kgfqiYPFLLLWRknTRSEWFPKIAr----sNWYKLFekIGVGLGIISLISGIA 77
gi 74567152   27 YLAVALFLSFWLIIYVFrrrlek---ynltvYPFFILWRk-KSREYWFPKFsr---sKGYRAYekIALPIGFLLMIAGIV 99
gi 48477878    4 YLIAALVVFAWIVIIIGlapsirkskyfsllGPALMVKSt-KNFGIIDWISkhfpgkIFSRISvvIVILGAISALGMLLY 82
gi 74510259    9 WFYLIAFILIWTMAILFrdrlk-----ieihGPLLMRRTk-RLRGFIDGLAsg--hpKLWRWImnAGIPVAFFFMFYMLY 80
gi 74570543    8 TYAILGILIFWALISILgtsmrs---esleiAPFQIIWRtkKFINFIDRIGrk--yqRFWKIYgdLGIITGFGGMIFVLY 82
gi 3024951     7 KVILIVAIIIWIILYSIrdsin----lktygGIFGILRTk-LGLKTIEKLGk----yKIWQKIgiISIPICVILGFFMLL 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                  ##  #                 
gi 91772313   81 IIIISDIAMLasigestlpepgkfnearnIFLIPGVNefi---plTWGVIALLVTLVVHEFSHAILCRVEGIRVKS-MGI 156
gi 74568974   80 ALVLVAITTLlnppept-----sisqpsnVLVIPGVNdflplsvaPEIIAGLFIGIVIHEFGHGLMCRVEGIDVESmGVA 154
gi 76801777   80 AVLASAIGALvepqatg------fvrpqdALVIPGVNqflpwaaaIDIVIGLLVGLVVHEGGHGLLCRVEDIDIESmGVA 153
gi 110667070  80 FLLIQGISILqnppaps-----avnqpenFLVIPGVNdflplsvaPEIIFGLLVGLVVHEGGHGILCRVEGIEIESmGVF 154
gi 15922403   78 LIFYVISEFIspkapq-------saqlrlEPVIPGVTigi--nqlPYILLAIGISVTLHELAHAVSATSNNVKVRS-GGF 147
gi 74567152  100 TILYIIIEMLtikpnq-------tptialKPIIPGVTisi--sqlPYILLAIGVSVAIHEIFHALSATSNNVKVKN-GGV 169
gi 48477878   83 ESYLAFFIPPsrap-----------alnlYLAIPGINpyi---piGYGIFALVFAVVIHEMFHGIVARRHGIKVNS-VGA 147
gi 74510259   81 MLVMSLQNIFvtpqa---------slivpGVDIPGSPvyv---plGYGIIGLATVIVVHEFAHGILARLEGVRIKS-IGL 147
gi 74570543   83 YFAKQAYNIIrpikpv--------tmpsvQLVIPGVTip-----lVYGLIALAILVIVHELSHGFVARSEDIPLKS-VGL 148
gi 3024951    78 NIIDMSIRLLsgtlpk--------eaakpVVFLFGDVip-----wIPGIIALLIAISVHELAHGIFAKSFGIKVKSsGIL 144
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 91772313  157 LLAIVPIGGFAEPDEEElfgvkkedteglganttdgpierrilgtekevmpkkvasreqRARILAAGVMSNFVVALIAFI 236
gi 74568974  155 LLAVLPVGAFVEPDQDSqada----------------------------------drgsKSRMFAAGVTNNFLVVVVTLA 200
gi 76801777  154 LFAFIPLGAFVQPDEESqdaa----------------------------------drggKTRMFAAGVTNNFLVTAVCFA 199
gi 110667070 155 LLTIIPLGAFVEPDEESerfa----------------------------------srggRTRMFAAGVTNNFAITIIAFV 200
gi 15922403  148 LFLIFFPGAFVEPDEEEynss----------------------------------nysvRLKILSAGLAVNLILAAIFFP 193
gi 74567152  170 LLLGIFPGAFVEPDEDDfnks----------------------------------tsnaKLKIIAAGIVINLVLALIALP 215
gi 48477878  148 LFFIVPVGAFVEPDEDEvtka----------------------------------dpviRRRIFAAGPGINIVIAVICIV 193
gi 74510259  148 LLLAILPGAFVEPDEEDikki----------------------------------rpisKMRIYAAGSVANLILAGICFA 193
gi 74570543  149 LLFIIIPGAFVEPDEDQlkka----------------------------------plrsRLRVFGAGSFANFVVALISLL 194
gi 3024951   145 LLLGLPLGAFVELGDEFktad-----------------------------------kkiRGAIASAGPLANLIIFLTSIP 189
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 91772313  237 LFFgpvlgaiapmsdtmiinvtsdssaniaglengmvitqiddtsiqkandiilymnnieagavvqvhaskdhnllvydv 316
gi 74568974  201 LLFgpvagavavsdgglvgevhdgtaaaaagfsggdritavggapvanntafrqaldeyddptvpvtlasnetvrverql 280
gi 76801777  200 LAFwmvasfisvapgvavggvlpgsaaddadldrgdvltavngqgvenvsefdaalsdadrevtverkdaapvdvqreli 279
gi 110667070 201 LLFgpiigsitvapglavsgaydespaatagieqgdrittvagtpisneselnnilsersnreitvkindgtsaakresq 280
gi 15922403  194 LAIylppmlsqglqivgelknypaynssipvnsiilgidghsihtstqletyl--------------------------- 246
gi 74567152  216 LSFelpylpsalsqgiiiegvlnntpaanaslhtgdiiysingyrlttlsqlh--------------------------- 268
gi 48477878  194 LLIfvmmpasapvhngiyiedsavssiptgteiiginnytgsmlcnieytsmirpgtivhaeiyngknvynesiyagvyi 273
gi 74510259  194 LFFgissfampaafqpdgvqidsvvpgspaskvltpglviesingmptsnlttysaalktisvg---------------- 257
gi 74570543  195 LVNgialafephgveiagtikdspaynvlqkgdviigingmkietleefmefmnktrpn--------------------- 253
gi 3024951   190 LLSfsytlptelkiidvkepaseflqkgdiiyeingkkinsledfkefak------------------------------ 239
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 91772313  317 evgndtddgikgmyvnnvvtdspaeamglesgmliikiddtaisssedfvtfmnftk----------------------- 373
gi 74568974  281 svvanasnsplsittndtitavngttvsteselraaladrevaafelndgaatatgpagalvttipdapaatdglsagtn 360
gi 76801777  280 vthavrdgpieqgavvatvdgdavytesalataiegterielglkdesdpvdipvgtfvstvpddeplgaagapdtpmvi 359
gi 110667070 281 tltverelivagsvggnpadinvdaegdpigvetvngtavytqagfsnavgtdrfieltttrgtttipagayltrvasdg 360
gi 15922403      --------------------------------------------------------------------------------
gi 74567152      --------------------------------------------------------------------------------
gi 48477878  274 enlisgypsekagvkpdsiimsidnktiynvntlgnvldhi--------------------------------------- 314
gi 74510259      --------------------------------------------------------------------------------
gi 74570543      --------------------------------------------------------------------------------
gi 3024951       --------------------------------------------------------------------------------
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 91772313  374 --------------------------------------tgqvisvetviagkatgdnvsseifeielashpeggsekgfl 415
gi 74568974  361 avvvs-----vngtrvptydalsgeldardpgdtisvgayvngsrttteitlgeqsdgssymgiapargvsgvavdgfga 435
gi 76801777  360 h-------------siggeqtpthealsdvlaetepgetvevvafhdedgdpwsgdrhtyevtlsahsdgdhgflgvggi 426
gi 110667070 361 plaqagvpsnpgvivtaidgqrvvssneltavldttqpgeevmveavvsgerkeysvrlgenpqdgsgflgvnifpgtsg 440
gi 15922403      --------------------------------------------------------------------------------
gi 74567152      --------------------------------------------------------------------------------
gi 48477878  315 -----------------------------------------------------rpgslinmtvfypashitktytmrtvs 341
gi 74510259      --------------------------------------------------------------------------------
gi 74570543      --------------------------------------------------------------------------------
gi 3024951       --------------------------------------------------------------------------------
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 91772313  416 giyyrpneieieivplgmsigefpakdylaalkaipsmlggftgwiiilglpifgfagegfpgfsgqlaqfyspigwgep 495
gi 74568974  436 tlypadtyrgllsgetsgsaylstlfggaddpitgflqavvialylpliglvdptlgfnfagiagmnasfyhvtgvlgvf 515
gi 76801777  427 qagisgfvfddfgidtypaeqyhemlggdglgenpvatfvsqtfgalvlpfmniidptvgynfagfngeitnfydvsgpl 506
gi 110667070 441 llltdfgaqsypagtylellggeggpgaiglsgtiadsplgavyvslvlplasvvlgipnfpgftgavhnfyaitgplep 520
gi 15922403  247 ------------------------------------------hrggiqtltllfpngsignvsvnisdpqhllgvyltyy 284
gi 74567152  269 -----------------------------------------ellynystititlkhpngslsnvsvnipnhflgvyvtyy 307
gi 48477878  342 tysyyakadpiqnsnayknqsfigveigysglgyepinyihklvfggylfgpgffdeiglpllglspipasmthlfkspf 421
gi 74510259  258 -------------------------------evinittdqgtfhlktgrnpnnssraymgirtsnhlrvrdsvasvlgdt 306
gi 74570543  254 -----------------------------------eeitltvirnkkiinisiilgehperagkgfigiyptqhwiskig 298
gi 3024951   240 --------------------------------------------tiepkkeyeikilrdnkiltykivssnegklgimvs 275
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                 #       #                                              
gi 91772313  496 lgigifwiantLLWVGWLNFYVGLFNCLPAVPLDGGHVFRDylhalisrfisde--akakevssaiaasFTMLILASFLF 573
gi 74568974  516 pdwvtfgaanvLLWTGWVNLNLALFNCIPAFPLDGGHLLRSaaeavtvrlpfe----rpetatraittgIGLLMLCSLLL 591
gi 76801777  507 gagivfalvnvLFWTGWVNINLGIFNCIPSYPLDGGHILRSsteavlarlpge----aspalagavttaVSLVMILSLLG 582
gi 110667070 521 igsgvflianiAFWTAWINLQLGIFNFIPGHPLDGGRILRTsaeavvsrlplpa--sgkrrlvrtittsVGIIMLLSLLL 598
gi 15922403  285 fppfiyslldfIIWMFTINFSLALFNGAPLIITDGGKVFNEllkkl-------------------gvneKTSYLIQGIIT 345
gi 74567152  308 ipdyiaailmfFTWLFIVNFSLAVFNAAPLIITDGGKLLTEllkrmlges-----------ngekisyyLQSLFLLIFIF 376
gi 48477878  422 dpyiffgianvLYWLFWIDFLLGITNALPLSILDGGQFFKDsltigsrrfrfl----kdeknvnriyygASVLVFLILIW 497
gi 74510259  307 lpfaltyleelFFWIFFLNFAVGTVNLLPAKPLDGGLMFEEllryrlper-----------ivkpavsyVSIFVILIIAV 375
gi 74570543  299 fdkpltivlttFYWIYVLNFGVGLMNLLPVIPLDGGRMLIDtltelspk-------------fgkaigySIMLISLLLLG 365
gi 3024951   276 ptkntalfintIYWTYWFNFLLALFNLLPAMPLDGFHVWNAfpellkerknrfiskvgqilelfinektLGSITLLVWWV 355

                 ....*
Feature 1             
gi 91772313  574 MIFGP 578
gi 74568974  592 MLFGP 596
gi 76801777  583 LLFIP 587
gi 110667070 599 LVFGP 603
gi 15922403  346 MLFIS 350
gi 74567152  377 AIFLS 381
gi 48477878  498 VIIAP 502
gi 74510259  376 SIIWG 380
gi 74570543  366 INLIP 370
gi 3024951   356 ILGSI 360

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap