Conserved Protein Domain Family
S2P-M50_PDZ_RseP-like

?
cd06163: S2P-M50_PDZ_RseP-like 
RseP-like Site-2 proteases (S2P), zinc metalloproteases (MEROPS family M50A), cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. In Escherichia coli, the S2P homolog RseP is involved in the sigmaE pathway of extracytoplasmic stress responses. Also included in this group are such homologs as Bacillus subtilis YluC, Mycobacterium tuberculosis Rv2869c S2P, and Bordetella bronchiseptica HurP. Rv2869c S2P appears to have a role in the regulation of prokaryotic lipid biosynthesis and membrane composition and YluC of Bacillus has a role in transducing membrane stress. This group includes bacterial and eukaryotic S2P/M50s homologs with either one or two PDZ domains present. PDZ domains are believed to have a regulatory role. The RseP PDZ domain is required for the inhibitory reaction that prevents cleavage of its substrate, RseA.
Statistics
?
PSSM-Id: 100084
View PSSM: cd06163
Aligned: 158 rows
Threshold Bit Score: 105.573
Threshold Setting Gi: 114800133
Created: 10-Dec-2007
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
active siteputative
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                      ##  #                                                             
gi 20978850    8 FIAFIIALGILVAVHEFGHFWVARRCGVKVEKFSIGFGKSIWkrvghdGTEYSISMIPLGGYVKMLDgrvddvp------ 81
gi 111023548   7 VVLFALGIALSIALHEAGHMWVAQATGMKVRRYFIGFGPKVFsfr-rgETEYGLKALPLGGFCDIAGmtaldele----- 80
gi 159036942   7 VTLFALAILISVSLHEAGHLLTAKAFGMKVTRYFVGFGPTLWsfr-rgETEYGIKGIPLGGFCKIVGmtpqdddv----- 80
gi 111225132  15 IVAFAAALLVSVVLHEGGHFVTARHYGLKASKFFVGFGPTIWsrq-rgETEYGIKAIPAGGFVKIEGmtpleeid----- 88
gi 20978863    7 IVLFALAILISVALHECGHMWVARRTGMKVRRYFVGFGPTLWstr-rgETEYGVKAVPLGGFCDIAGmtpveeld----- 80
gi 20978852    6 IVLFAVGLLFSIAWHELGHLSTAKMFGIRVPQYMVGFGPTLFskk-kgDTEYGVKAIPFGGYIRMIGmfppgpdgrmear 84
gi 19553218    8 VVLFFLGIAVTIALHEWGHFITARIFGMKVRRFFIGFGPTVFakr-rgETVYGLKAIPVGGFCDIAGmtaqdeld----- 81
gi 119717427  10 VVIFVVAILVSIGLHELGHMIPAKRFGGKVTQYFIGFGPTVWskr-vgETEWGVKAIPLGGYVKIVGmlppgaeeiadev 88
gi 50842987   10 GIVFFGLIILSVLLHECGHFIPAKIFGVKVTEFFAGFGPKIWsft-pgETEYGFKWIPLGGYVRLIGmypakvhhrhsnr 88
gi 28572265    6 VLIILIFVYIAVALHELGHMLPAKYFGVPVQKYAIGFGPSLFsfk-krETSYSFNLLPLGGYVQLEGmlppsenprrwfk 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 20978850   82 ------------------------------------aeqqamaFDKQSLWKRSAIVSAGPIFNFLFAIFAYWLVfmigvp 125
gi 111023548  81 ------------------------------------pdeedraMYKKPTWKRLAVMSGGIGMNFVLGLVLVYVLavgwgl 124
gi 159036942  81 -----------------------------------epadqpraMWRFPVWKRTVVMAAGSIAHFALALIALWIIaitagl 125
gi 111225132  89 ------------------------------------pedepraFHNARARARLVVMSAGSFVHFVIAIVLIYAVlvtlgt 132
gi 20978863   81 ------------------------------------pderdraMYKQATWKRVAVLFAGPGMNLAICLVLIYAIalvwgl 124
gi 20978852   85 stspwrgm---------------iedarsaafeelqpgdekrlFYTRKPWKRVIVMFAGPFMNLILAVVLFLTVlmgfgi 149
gi 19553218   82 ------------------------------------pedlpraMYLKPWWQRIIVLSGGVIMNLIVGFLVLYGVavssgi 125
gi 119717427  89 tvdadgnqvvrvrksntgmftqlisdaraaewetirpedserlFYKMPWWKKVVVMAGGPTVNLLIAFTIFWGIfglygv 168
gi 50842987   89 ltrfad-------------------earvaevegitdadqgrlFSDKPVWQRLIIMSGGILTNLLLAFLLFWAVfgihgr 149
gi 28572265   85 ------------------------------klmkfaesdspraFWRLPAWKKIIVMFSGPFVNLILATLGYVFVlsvlgl 134
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 20978850  126 avkpvigevtpysiaaqaglepgmeikavsgvntpdwesvnmglighigddsmtitvssaegvglneiktinlrdwnfdp 205
gi 111023548 125 pdlnrstdavvgsvgcaaptqgpgpdyalsectgpgpaeqagirtgdvitavdgkdtptfadvaaatrslsgpvdftier 204
gi 159036942 126 pnpnfpstlaqirqepaiiqlatcvvpenevractdadpaspaaqgelrdgdritavngtavtnygdllvalraqqpgqq 205
gi 111225132 133 kqvseskigstscvattakcsgpgpaaaagmrpddrivsfdgvavhtwkdftrrvrehgagpaslvverdgrqltlapdl 212
gi 20978863  125 pnlhpptravigetgcvaqevsqgkleqctgpgpaalagirsgdvvvkvgdtpvssfdemaaavrkshgsvpivverdgt 204
gi 20978852  150 sqqtttvssvsqcvisqsenpddcaksdpaspaaaaglragdkilafdgvrtddwdklsdliranpgedvpvvverkgee 229
gi 19553218  126 pnpdvdttatvdtvqcvpetqisatelsscvgsgpagdagiehgdkilavngqemasftairdailelpgetatltiere 205
gi 119717427 169 rtaepdagapvidevsqcvipyaesgrectdsdplspaaeaglrpgdvvttfngtaitgwdqlrsairgnddgkavigye 248
gi 50842987  150 adqtttvaavtpcahsaqtsgpcskedrrapaaeagvragdrivsfngrqvdswsqlqefirgngggevrlgverdgafv 229
gi 28572265  135 pvikpviheviantpaasagilpgdeiiaindtaisspgqirgliqdkdlvtlsllkdggtrivslrplngsig------ 208
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 20978850  206 etesamgalgfkpftpeisnqltnvsaqgageraglqvgdtvlqingqaveawqqvvnaiqshpnapiavmveragqqve 285
gi 111023548 205 dgeeqtivvpvqqvq-------------------------------------------------------------rwvq 223
gi 159036942 206 aqvaylrddqpgtatvtlg-----------------------------------------------------qtqrppld 232
gi 111225132 213 vevrrnrvt----------------------------------------------------------------------- 221
gi 20978863  205 aivtyvdiestqrw---------------------------------------------------------------ipn 221
gi 20978852  230 itlhatiatnkvakk-------------------------------------------------------------dsng 248
gi 19553218  206 gtlfdvdlqvasv----------------------------------------------------------------trl 221
gi 119717427 249 rdgqsmtgttsttvea----------------------------------------------------------rptsat 270
gi 50842987  230 sltpthtlltkvp-----------------------------------------------------------------dl 244
gi 28572265      --------------------------------------------------------------------------------
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 20978850  286 ltlipdsrelsqgkvigfagiapkvaewpqnyrfelqfgvfeslgkaveksgqvidltvsmlkkllvgdvglnnlsgpis 365
gi 111023548 224 eegetepheatvgaigvgatpsvvehsalsavpasleftgdmfvmtaerlvqmpskavdlwhavtggerdpetpisvyga 303
gi 159036942 233 dpegtvgpvaalgvglipstptrieygpigaiggtadftgtmavntyeamkripqkvpalwtaitggerdvdtpisvvga 312
gi 111225132 222 --gesgddrvgalgvrpgldtvhynpieavpqtfkvigsgftgmyntlthrigdvgkifsndrdpqgfisvvgaariggd 299
gi 20978863  222 gqggelqpatvgaigvgaarvgpvrygvfsampatfavtgdltvevgkalaalptkvgalvraigggqrdpqtpisvvga 301
gi 20978852  249 qivqgeyvtagflgfssatgvvkqdfgqsvtwmgdrigdavdnlaalpakipalwdaafgdgpreadspmgvvgaarvgg 328
gi 19553218  222 asdgseitvgavgmsslpptdvykkygpiegvgatarftgdmisatwdglkafpakipgvvasifgaerdvespmsvvga 301
gi 119717427 271 detlhqvgflgvtptthevtttggpiytldqmgemtvvtvkalgtlpvkvwgvakaivgveersidspvsivgggriage 350
gi 50842987  245 stpgrtveagylgvsptmvivhsgpgdtvsqmwtmskqslsalarlpvltwnvasdlvtgqardanspmsivgasrvagd 324
gi 28572265  209 ----------------vkfstvnerqsifdalssmvkdtvgvakslialpynlftgladtlhqrkdgvvgligaarisgd 272
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                      #       #                                         
gi 20978850  366 iakgagttadygfvyfLGFLALISINLGIINLVPLPMLDGGHLLFFMIEAVIRRpvp-----------ekvQEMGYRIGG 434
gi 111023548 304 sviggqiaeqgiweafVLLLASLNFFLGMFNLLPLLPLDGGHMAVTVYERVRDWfrsrrglp-sggpvdymKLLPVTYVV 382
gi 159036942 313 sriggeavennawllfFMLFVSLNFFIGVFNLLPLLPLDGGHIAIAWFERARSWvyarlrrp-dpgrvdylKLMPFTYAV 391
gi 111225132 300 vvsapdssvldrigqfLILVAAINLAVGIFNLLPLLPLDGGHIAVLGFEQARHGlrrlrgyrgpvqkvdfaKLLPATYAT 379
gi 20978863  302 siiggdtvdhglwvafWFFLAQLNLILAAINLLPLLPFDGGHIAVAVFERIRNMvrsargkv-aaapvnylKLLPATYVV 380
gi 20978852  329 eiatldipptqqlamfVMLVAGFNLSLFLFNMLPLLPLDGGHIAGALWESLRRAtakvlrrp-dpgpfdvaKLMPVAYVV 407
gi 19553218  302 sriggefversmwdmfMMMLASLNFFLALFNLVPLPPLDGGHIAVVIYEKIRDFfrklrgkp-aggpadytKLMPVTVAV 380
gi 119717427 351 tvshqdfpvaekavylLSLIAGFNFFIGMFNFIPLLPLDGGHIAGALWEAVRRGfarlrgrp-dpgyvdvaKLLPIAYGV 429
gi 50842987  325 vagdsqltlgdkiatgASLLGGLNLFLFWFNVVPLPPMDGGHIAGAIYEAGKRGlfklarkp-dpgpadtaMMLPVAWTI 403
gi 28572265  273 ivsapsislydklrsmIWIFASLNLALFVFNMIPLLPFDGGYIAAAVFEGARSRvllafrkn-dyapvnisYLLPVTLLV 351
                        490
                 ....*....|....*...
Feature 1                          
gi 20978850  435 AIIFSLMAVAIFN-DFTR 451
gi 111023548 383 IIIGGAYMLLTLTaDIVN 400
gi 159036942 392 ILIGGAFTLLTITaDVVN 409
gi 111225132 380 VVVLLGFSLLLLSaDIFN 397
gi 20978863  381 LVLVVGYMLLTVTaDLVN 398
gi 20978852  408 AGVFVCFTLLVLVaDVVN 425
gi 19553218  381 AALLMTVGGLVIVaDVVN 398
gi 119717427 430 AAVLLVMGVVLIVgDLVV 447
gi 50842987  404 GALMLMMGLVLVVaDVVS 421
gi 28572265  352 TAAIIVMSIMLAWiDIVN 369

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap