Conserved Protein Domain Family
phenol_2-monooxygenase_like

?
cd06211: phenol_2-monooxygenase_like 
Phenol 2-monooxygenase (phenol hydroxylase) is a flavoprotein monooxygenase, able to use molecular oxygen as a substrate in the microbial degredation of phenol. This protein is encoded by a single gene and uses a tightly bound FAD cofactor in the NAD(P)H dependent conversion of phenol and O2 to catechol and H2O. This group is related to the NAD binding ferredoxin reductases.
Statistics
?
PSSM-Id: 99807
View PSSM: cd06211
Aligned: 10 rows
Threshold Bit Score: 378.205
Threshold Setting Gi: 169824795
Created: 2-Apr-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:FAD binding pocket [chemical binding site]
Evidence:
  • Comment:contacts lie primarily in N-terminal region
  • Comment:based on Acinetobacter sp. Benzoate dioxygenase reductase (1KRH) and Methylococcus capsulatus Methane monooxygenase (1TVC)

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                #                      ####             
gi 119898141  99 NLPVRDFdGVVSRIESLTPTIKGVWVKLDEpegmrFQAGQYINLHLPDGi-----------gTRAFSIASAPsaaGEIEL 167
gi 5851794    98 GLPLADYrAEVVEARALTPTIRGIWLRVKGgaaaaFQAGQYLNLRVPGCd-----------qPRAFSLANRPg-dDLVEL 165
gi 57207888   99 CLPLMDFtAEVVRIKALTPTIKGVFLRIEGes-lqFQPGQYVNVWIGKEa-----------aPRAFSVASAPs-aNEIEL 165
gi 483483     99 GHHVEDYrGVVSALVDLSPTIKGVHIKLDRpm--tFQAGQYINLTLPGVe-----------gSRAFSLANPPsqaDEVEL 165
gi 39931048   99 GHLVQDYqATVIEIKDLSPTIKGIRLQLDRpi--eFQAGQYINVQFPNIe-----------gTRAFSIANSPsevGIVEL 165
gi 29647422   99 NLPVRDFtGTVNRIEALTPTIKGVWIKLDDaagmrFQAGQYINLQLPDGi-----------gSRAFSIASAPaasGEIEL 167
gi 150390938 125 LLNVKQFeAIVEKTEDLTSTIKLLRLKITDgqeieFKAGQYVQLLAPPYpgsp------devFRAYSIASSPnnkGYIDL 198
gi 160901557 126 LFSAKIFkGVVEKINDLTYDIKEVKIKLVEpneieFKAGQYMQLVIPPYekin------eytQRAYSIASSPsqkDSIEF 199
gi 169824795 125 LFNVKEYeTTLVEKLPLTDRITKFRFELPEgetikFKPGQYVQLKAEEYpkgdgyegsdeevFRAYSIASSIrdeKHIEL 204
gi 162447824 124 VLNVKPFyGKVVEVEQLTHDIRRIKFEMKEdf--vFKPGQYLQIEVPGIe-----------tTRAYSIASNPndlRHPEV 190
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        ### #   ###                                      #  #                           
gi 119898141 168 NIRIVaGGQGTAYVHEKLKAGDAIRITGPYGRFFVKKSAkVPVVFMAGGSGLSSPRSMILDLLEEGFD-LPITLVYGQRS 246
gi 5851794   166 HVRRVeGGQATGYLHDQLSVGDELGFSAPYGRFFVRKSAqKPMLFLAGGSGLSSPRAMILDMLAAGET-LPITLVQGARN 244
gi 57207888  166 NIRLVpGGSATTYVHEQLGVGERLQLSGPLGRFFVRKSDpRPLVFMAGGSGLSSPRSMILDLLESGDQ-REIVLVQGARN 244
gi 483483    166 HIRLVeGGAATSFIHRQLKVGDAVELSGPYGQFFVRDSQaGDLIFIAGGSGLSSPQSMIFDLFERGDT-RQITLFQGARN 244
gi 39931048  166 HIRKVeGGAATTYVHEQLATGDQLDISGPYGQFFVRKSDdQNAIFIAGGSGLSSPQSMILDLLESGDS-RTIYLFQGARD 244
gi 29647422  168 NIRIVpGGRGTGYVHEQLQVGERIVVTGPYGRFFVKKSAqVPVIFMGGGSGLSSPRSMILDLLEDGFD-LPITLIYGQRN 246
gi 150390938 199 IIGYVpDGLLTTYVHKHLSEGDEILFNGPFGDFYLQDCE-EDAILVAVGTGMAPIRSILFEMLNKKID-RNTIFFFGAKT 276
gi 160901557 200 FIRLVpGGIATTYVHKYLKENDQMELVGPFGEFYMRDTD-ADMICVAGGSGLAPIKSIVADMFEREITnRNVWLFFGARS 278
gi 169824795 205 LIGYT-KGICTTYCHKVLKEGDKVTINGPYGDFYYHDED-TEIILGAAGTGFAPIRSILNHMRDHDVK-RKARFYFGAKT 281
gi 162447824 191 IIRLVpGGVATKFIHKALVIGDTLKITGPFGDFFLQEEStRPIIMIAGGSGKAPIRSIIYKLIEQNMP-RKAQYFFGART 269
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 119898141 247 RAELYYHDEFLALAqRHPNFRYVPALSHEPegSDWNGFRGFVHEAAKAAFdn----dFRGHKAYLCGPPLMIDACITTLM 322
gi 5851794   245 RTELYYDEAFRALAgAHPNFRYVPALSDEPadSGWDGARGYVHDVLHGLYangatadFRGHKAYLCGPPPMIEACIRTLM 324
gi 57207888  245 AGELYYRDAFETIArQHDNFTYLPVLSGEPeqSDWAGERGYVHDLAGRHFsh----dFRGWRAYLCGPPPMIEACIATLM 320
gi 483483    245 RAELYNRELFEELAaRHSNFSYVPALNQAHddPEWQGFKGFVHDAAKAHFdg----rFSGHKAYLCGPPPMIDAAITTLM 320
gi 39931048  245 LAELYNRELFEQLVkDYPNFRYIPALNAPKpeDQWTGFTGFVHEAVADYFen----rCGGHKAYLCGPPIMIDSAISTLM 320
gi 29647422  247 RDELYYHEEFLAMAqQHPNFTYVPALSHEPegSDWQGFRGFVHDAAKAHFnn----dFRGHKAYLCGPPLMIDSCISTLM 322
gi 150390938 277 PEDLFLLDEMTMFEkELPRFKFVPTLSRAPeeSQWKGEEGRVTDAMMKFLe-----kKEGREAYLCGSAPMIDSTVKTLV 351
gi 160901557 279 LKDLYYLDFFQDMEkKWDRFHFVPALSEPQpeDNWKGETGLITDVLGKYFkek-mdqNTQKEGYLCGSPGMINACVKVMT 357
gi 169824795 282 PDDLFLLDELKQFEeDLYDFKFIPVLSRTTpeMNWEGDTGHADDAIKKYCke----tGKNSSAYLCGSPRMIESLTKALN 357
gi 162447824 270 KKDLYYTKEFKDVEaMYPNFKYIPALSTPLpeDEWDLDIGLITEVVARHTg-----dLSGHEAYLCGSPGMIDACIKVLR 344
                        250
                 ....*....|....
Feature 1                   # #
gi 119898141 323 QGRlfERDIYMEKF 336
gi 5851794   325 QGRlfEEDIHTEKF 338
gi 57207888  321 QGRlfEKDIFTEKF 334
gi 483483    321 QGRlfERDIFMERF 334
gi 39931048  321 QSRlfERDIHTERF 334
gi 29647422  323 QGRlfERDIYTEKF 336
gi 150390938 352 ERAfaDNKIYYDKF 365
gi 160901557 358 ANGisEDKIYYDKF 371
gi 169824795 358 EVGvtDDRIYYDNF 371
gi 162447824 345 EKGmpEEHIYFDKF 358

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap