Conserved Protein Domain Family
PBP1_iGluR_NMDA_NR2

?
cd06378: PBP1_iGluR_NMDA_NR2 
N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR2 subunit of NMDA receptor family
N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR2 subunit of NMDA receptor family. The ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptor serves critical functions in neuronal development, functioning, and degeneration in the mammalian central nervous system. The functional NMDA receptor is a heterotetramer composed of two NR1 and two NR2 (A, B, C, and D) or of NR3 (A and B) subunits. The receptor controls a cation channel that is highly permeable to monovalent ions and calcium and exhibits voltage-dependent inhibition by magnesium. Dual agonists, glutamate and glycine, are required for efficient activation of the NMDA receptor. Among NMDA receptor subtypes, the NR2B subunit containing receptors appear particularly important for pain perception; thus NR2B-selective antagonists may be useful in the treatment of chronic pain.
Statistics
?
PSSM-Id: 107373
View PSSM: cd06378
Aligned: 17 rows
Threshold Bit Score: 343.538
Threshold Setting Gi: 47216887
Created: 13-Jul-2007
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
putative
Feature 1:putative dimerization interface [polypeptide binding site]
Evidence:
  • Comment:based on sequence similarity to mGluR

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 14548162    33 PSIGIAVILvgt---------------------------------sdEVAIKDAHEKDDFhh------------------ 61
gi 2492629     28 QGMTVAVVFsss--------------------------------gppQAQFRARLTPQSFld------------------ 57
gi 47217954    27 RGGGVQRRHlpg---------------------------------rdQRQVEPGELHGPAp------------------- 54
gi 47220672    32 PSINVAVVFsgs---------------------------------syQTEVRGRLSGENFvd------------------ 60
gi 125812378   28 PILNIAVILgqtr-------------------------------yisDRDIRALWSKDDP-------------------- 56
gi 47218959    65 PALSVAVVMgqtr-------------------------------hvsDQLLRPPRRPGDP-------------------- 93
gi 118098077   29 PVLNIAVILgrtk-------------------------------ditERDIRSLWTREMSad------------------ 59
gi 18201966    49 RPLNVALVFsg----------------------------------paYAAEAARLGPAVAaavr---------------- 78
gi 94733332    42 GGVNIAVVHsgsshlpetsagvggvggassagsgsgagpssssgssgTAFLSRAWSGQVGesvm---------------- 105
gi 47216887    39 GGVNIAVVHsgss------------------------------llpeTATVGGAGVGEPGpglgnglgggkglvdsavle 88
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                      # ##  ##                           
gi 14548162    62 ----------------------------lsVVPRVELVAmNETDPKSIITRICDLMSDRKIQGVVFADDtdqea------ 107
gi 2492629     58 ----------------------------lpLEIQPLTVGvNTTNPSSLLTQICGLLGAAHVHGIVFEDNvdtea------ 103
gi 47217954    55 ------------------------------GGEPHPPVLvNNTNPRTLLTRICDTLSTNRVHGIVFEDNvgsea------ 98
gi 47220672    61 ----------------------------lpVVVSPVTVLvNDTNPRDLLTHLCDTMATEKLHGVVFEDDvgsgagaq--- 109
gi 125812378   57 ------------------------------IDVNVVTLLvNETDPKSIITHVCDLMSGTKIHGVVFGDGtdqea------ 100
gi 47218959    94 ------------------------------IDISVVTLRmNQTDPKTIITQVCELLSRTRLHGIVFADGtdqea------ 137
gi 118098077   60 ----------------------------ltIEVNVVTLLvNQTDPKSIITHVCDLMSGTKIHGVVFGDDtdqea------ 105
gi 18201966    79 ---------------------------spgLDVRPVALVlNGSDPRSLVLQLCDLLSGLRVHGVVFEDDsrapa------ 125
gi 94733332   106 ---------------------------tpwGPANVIWLAvNESSPGSLLLQLCELLATTPLQGLVFEEEkppppnr---- 154
gi 47216887    89 gaeamasysassvaslslaalvgetvmtpsGHANVIYLAvNESSPGSLLLQLCELLATTPLQVDAPAPPggegdwslrrr 168
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                      #  
gi 14548162   108 ------------------------------------------------------------------iaqiLDFISAQTLT 121
gi 2492629    104 ------------------------------------------------------------------vaqiLDFISSQTHV 117
gi 47217954    99 ------------------------------------------------------------------vaqiLDFISTQTTV 112
gi 47220672   110 ---------------------------------------------------------------vaevaqiLDFLSTQTAL 126
gi 125812378  101 ------------------------------------------------------------------iaqiLDFISSQTLI 114
gi 47218959   138 ------------------------------------------------------------------iaqiLDFLSVQTQL 151
gi 118098077  106 ------------------------------------------------------------------vaqiLDFISSQTSI 119
gi 18201966   126 ------------------------------------------------------------------vapiLDFLSAQTSL 139
gi 94733332   155 ----------------------------------------------------------------aplapmLEFVSAQTGV 170
gi 47216887   169 drrhptaplwrpcwslclrrrdclwwlsgagpawdgnrrhhksaaaglisdlsrisveaagcsprflfirNHPSSLQSKL 248
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 14548162   122 PILGIHGGSSMIMADKDe-----------------------------------SSMFFQFGPSIEQQASVMLNIMEEYDW 166
gi 2492629    118 PILSISGGSAVVLTPKEp-----------------------------------GSAFLQLGVSLEQQLQVLFKVLEEYDW 162
gi 47217954   113 PIVGISGGSAVVLPHKGe-----------------------------------GSNFLQLGSSIEQQINGMFKVMEEYNW 157
gi 47220672   127 PIVGISGGSAIVIPYKVqsnlpas-----------------------saweaeGSSFLQMGASLEQQVLCMFKMMEEYDW 183
gi 125812378  115 PILGIHGGSSMIMADKDv-----------------------------------KSTFFQFGASIQQEALLMLNIMEEYDW 159
gi 47218959   152 PVLGVHGGSSMIMADKFpksvvcervdalvseatgfkhlphscsqspsghwdeKSTFFQFGAALQQEALLMLAIMEEYDW 231
gi 118098077  120 PILGIHGGASMIMADKDv-----------------------------------MSTFFQFGASIQQEAIVMLKIMQDYDW 164
gi 18201966   140 PIVAVHGGAALVLTPKEk-----------------------------------GSTFLQLGSSTEQQLQVIFEVLEEYDW 184
gi 94733332   171 PVIAVGGGAGLGREPQEs-----------------------------------GSVYLQFSCSTDLQLEVIFEVLEEFDW 215
gi 47216887   249 EHHSLEHCLMTPETADAae---------------------------------sGSIYLQFTCSTALQLEVIFEVLEEYDW 295
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                              #  #             # #                                       
gi 14548162   167 YIFSIVTTYFPGYQDFVNKIRSTIENSFVGWELEEVLLLDMSldd-gdSKIQNQLKKLQSPIILLYCTKEEATYIFEVAN 245
gi 2492629    163 SAFAVITSLHPGHALFLEGVRAVADASHVSWRLLDVVTLELGpgg-prARTQRLLRQLDAPVFVAYCSREEAEVLFAEAA 241
gi 47217954   158 ENFVVITSLYPGYETYVDYIKSFIDTSYFKWELQDVLMFDMSadglndVRARRLLQQIDTQVLLVYCSHEEAQYLFAMAA 237
gi 47220672   184 GEFAVITSLLPGYDTFVDIVETYTDTSYFLWNVQDVLSLEMSvga-seAKTKRLLQQLDSQVLLAYCSYDEAQFLFRQAA 262
gi 125812378  160 HVFSIVTSKFPGYQDFIAILKTTVDNSFVGWDLQHIITLDAVdg---dSRTQIQLKKVQSPVVLLYCSKDEAAYILEEAR 236
gi 47218959   232 HVFSIVTSKFPGYQEFISTLRVTVDHSFVRWDLQSVVTLDAMdgd-pnSKSHIALKRIQSPVILLYCSKDEAVYILEEAR 310
gi 118098077  165 HVFSLVTTTFPGYRDFINVIKTTVENSFVGWDMQNIIILDTAfg---dAKTQIQLKKIHSSVILLYCSKDEAVYILDEAR 241
gi 18201966   185 TSFVAVTTRAPGHRAFLSYIEVLTDGSLVGWEHRGALTLDPGag---eAVLSAQLRSVSAQIRLLFCAREEAEPVFRAAE 261
gi 94733332   216 TAFSVVTTRHHGYEDFLAMVEGMIDGSFIGWERKSVVMLNLTddp-ggARTRRLLKENEAQVRLLYCSQEEAEQIFKAAW 294
gi 47216887   296 TAFSVVTTRHHGYEDFLAMVEGTTDGSFIGWEIKSIVILNVTddp-ggARTKRLLKDNEAQVRLLYCSLEEAELVFRAAW 374
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 14548162   246 SVGLTGYGYTWIVPSLVAGdt-----------dTVPAEFPTGLISVSYDEWDYg-------------------------- 288
gi 2492629    242 QAGLVGPGHVWLVPNLALGst-----------dAPPATFPVGLISVVTESWRLs-------------------------- 284
gi 47217954   238 ESGLVGPGYIWIVPSLAVGnp----------diPPPDSFPVGLISIITDRWRMs-------------------------- 281
gi 47220672   263 EVGLVGPGYIWIIPSLAVGnp----------nsPPPDSFPVGVIGVITDQWRKs-------------------------- 306
gi 125812378  237 SLGLTGFGYIWIVPSLTTGnp-----------eITPDTFPSGMISVSYDDWDYp-------------------------- 279
gi 47218959   311 SLGLIGAGYIWIVSSLTTGnp-----------dLTPEIFPLGMISVSYDDWEYp-------------------------- 353
gi 118098077  242 SLGLTGYDFFWIVPSLVSGnt-----------eITPKEFPSGLISASYDEWDYs-------------------------- 284
gi 18201966   262 EAGLTGSGYVWFMVGPQLAggggsgapgeppllPGGAPLPAGLFAVRSAGWRDd-------------------------- 315
gi 94733332   295 ASGQATPSHMWFAVGPGLSg-------------LGLEGLPKALFAVRPQGWRDe-------------------------- 335
gi 47216887   375 AAGQAGPSHMWFAVGPALSg-------------LGLEGLPKALFAIRPQGWRDeprrrvshqqrlaavlahyqflqdfrs 441
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 14548162   289 -------------------------------------------------LPARVRDGIAIITTAASDml--seHSFIPEP 317
gi 2492629    285 -------------------------------------------------LRQKVRDGVAILALGAHSyw--rqHGTLPAP 313
gi 47217954   282 -------------------------------------------------LRKRVRDGVAIVVKGMQSfr--kqRGFIPEG 310
gi 47220672   307 -------------------------------------------------LRQRVREGVAIVAKGAESfk--kqHGFVPEG 335
gi 125812378  280 -------------------------------------------------LEARVRDGLGIITTAAAAml--eeFGDIPEA 308
gi 47218959   354 -------------------------------------------------LDTRVRDGVSIVSLAATSml--reKGELPEA 382
gi 118098077  285 -------------------------------------------------LEARVRDGLGIIATAASAml--ekYSFIPEA 313
gi 18201966   316 -------------------------------------------------LARRVAAGVAVVARGAQAll--rdYGFLPEL 344
gi 94733332   336 -------------------------------------------------PRRRIAKGVSVLTHGAMAlrreygGARGTSF 366
gi 47216887   442 sstdaelvqfhvneplwlqggsifhirfstgscglhlsppwwslifavwSCRRIAKGVSVLAHGAMAlrrdqgASSRSQY 521
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 14548162   318 KSSCYNthekr--------------------------------------------------------------------- 328
gi 2492629    314 AGDCRVhpgpv--------------------------------------------------------------------- 324
gi 47217954   311 HSDCHNpakt---------------------------------------------------------------------- 320
gi 47220672   336 HGDCTKpakh---------------------------------------------------------------------- 345
gi 125812378  309 KTSCYGqmekt--------------------------------------------------------------------- 319
gi 47218959   383 QSSCYStasdrs-------------------------------------------------------------------- 394
gi 118098077  314 KTSCYGqlekn--------------------------------------------------------------------- 324
gi 18201966   345 GHDCRAqnrt---------------------------------------------------------------------- 354
gi 94733332   367 AGNCMMdgnq---------------------------------------------------------------------- 376
gi 47216887   522 AGNCQTdsnqthrvpdrlrrrqrravmeavvkpintpqprlqietwqktnsprvllnrsavetrrcrreetlrqapaavs 601
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 14548162       --------------------------------------------------------------------------------
gi 2492629        --------------------------------------------------------------------------------
gi 47217954       --------------------------------------------------------------------------------
gi 47220672       --------------------------------------------------------------------------------
gi 125812378      --------------------------------------------------------------------------------
gi 47218959       --------------------------------------------------------------------------------
gi 118098077      --------------------------------------------------------------------------------
gi 18201966       --------------------------------------------------------------------------------
gi 94733332       --------------------------------------------------------------------------------
gi 47216887   602 rhfisgrlkldlitsrpegvdpglcpclkswirrswtsssassgcedaplsptcdrcpsqpesfphpgvprslvfgcsmg 681
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 14548162   329 ----------------------------------iyqsNMLNRYLINVTFEGRNLSFSEDGYQMHPKLVIILLnkerkWE 374
gi 2492629    325 ----------------------------------sparEAFYRHLLNVTWEGRDFSFSPGGYLVQPTMVVIALnrhrlWE 370
gi 47217954   321 ----------------------------------ppenDTLFRHMLNVTWENNDFSFNSDGYLVNPAMIIITLdrerqWD 366
gi 47220672   346 ----------------------------------ssdnNTLFRHMLNVTWERKDLSFNNQGFLSNPSMVIIALdreriWD 391
gi 125812378  320 ----------------------------------klppSALHKYMMNVTWDGKDLSFTEDGYQVHPKLVVIVLnkdreWE 365
gi 47218959   395 --------------------------------pgklppSALRRHMMHVWNEGRDLSFTPDGYQANPRLVVIVLnnerkWE 442
gi 118098077  325 ----------------------------------drpsHTLHQFMMNVTWEGKDLSFTADGYQAHPRLVVIVLnkdrvWE 370
gi 18201966   355 -----------------------------------hrgESLHRYFMNITWDNRDYSFNEDGFLVNPSLVVISLtrdrtWE 399
gi 94733332   377 ----------------------------------tqrvPGRIRFFSNITLSGRDYSFNNDGYLANPLLDVISYtagrgWE 422
gi 47216887   682 qfsppsrepgrgptetlvwdqggllqwgpgtlvtgippQTEARYFTNISIGGRDYSFNSDGYLSNPLLDVISYingrgWE 761
                         810
                  ....*....|....*....
Feature 1                            
gi 14548162   375 RVGKWKDKSLQMKYYVWPR 393
gi 2492629    371 MVGRWEHGVLYMKYPVWPR 389
gi 47217954   367 KVGTYETGILQMRYPVWPR 385
gi 47220672   392 KVGTYARGILQVRYPVWPR 410
gi 125812378  366 KMGKWENQSLTLKYPVWPR 384
gi 47218959   443 KMGRWENGTLSLMFPVWPR 461
gi 118098077  371 KVGKWENNSLSLKYSVWPR 389
gi 18201966   400 VVGSWEQQTLRLKYPLWSR 418
gi 94733332   423 EVGWWENGVLRLRYPPWSR 441
gi 47216887   762 EVGWWENGHLRLRYHPWSR 780

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap