Conserved Protein Domain Family
PBP1_iGluR_AMPA_GluR4

?
cd06388: PBP1_iGluR_AMPA_GluR4 
N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor
N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid) receptor. The AMPA receptor is a member of the glutamate-receptor ion channels (iGluRs) which are the major mediators of excitatory synaptic transmission in the central nervous system. AMPA receptors are composed of four types of subunits (GluR1, GluR2, GluR3, and GluR4) which combine to form a tetramer and play an important role in mediating the rapid excitatory synaptic current. Furthermore, this N-terminal domain of the iGluRs has homology with LIVBP, a bacterial periplasmic binding protein, as well as with the structurally related glutamate-binding domain of the G-protein-coupled metabotropic receptors (mGluRs).
Statistics
?
PSSM-Id: 107383
View PSSM: cd06388
Aligned: 4 rows
Threshold Bit Score: 777.665
Threshold Setting Gi: 134024236
Created: 11-Feb-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
putative
Feature 1:putative dimerization interface [polypeptide binding site]
Evidence:
  • Comment:based on sequence similarity to mGluR

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                         # ##  ##                       
gi 1346142    28 QIGGLFirNTDQEYTAFRLAIFLHNTAPnaseAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYdkRSVHTLT 107
gi 134024236  28 QIGGLFirNTDQEYTAFRLAIFLHNTSPneseALFNLVPHVDNIETSNSFAVTNAFCSQYSRGVFAIFGLYdkRSVHTLT 107
gi 164419768  28 QIGGLFirNTDQEYTAFRLAIFLHNTSPnaseAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYdkRSVHTLT 107
gi 47550905   23 QIGGLFirNTDQEYTAFRLAIFLHNTSPnateAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYdkRSVHTLT 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1             #                                                       #  #             # 
gi 1346142   108 SFCSALHISLITPSFPteGESQFVLQLRPSLRGALLSLLDhyeWNCFVFLYDTDRGYSILQAIMEKAGQNGwHVSAICVE 187
gi 134024236 108 SFCSALHISLITPSFPteGESQFVLQLRPSLRGALLSLLDhygWNHYVFLYDTDRGYSILQAIMEKAGQNGwQVSAICVE 187
gi 164419768 108 SFCSALHISLITPSFPteGESQFVLQLRPSLRGALLSLLDhyeWNRFVFLYDTDRGYSILQAIMEKAGQNSwQVSAICVE 187
gi 47550905  103 SFCSALHISLVTPSFPaeGETQFVLQLRPSIRGALLSLLDhydWSRFVFLYDTDRGYAVLQAIMEKAGQNGwQVSAICVE 182
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #                                                                               
gi 1346142   188 NFNDVsYRQLLEELDRRqekKFVIDCEierLQNILEQIVSVGkHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLvdf 267
gi 134024236 188 NFNDAsYRRLLEDLDRRqenKFVIDCEverLQNILEQIVSVGkHVKGYHYIIANLGFKDISLDRFMHGGANVTGFQLvdf 267
gi 164419768 188 NFNDAsYRRLLEDLDRRqekKFVIDCEierLQNLLEQIVSVGkHVKGYHYIVANLGFKDISLERFMHGGANVTGFQLvdf 267
gi 47550905  183 NFNDAsYRRLLEDLDRRqekKFVIDLEaerLQNILEQIVSVGkHVKGYHYIVANLGFKDISLERFMHGGANVTGFQLvdf 262
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 1346142   268 ntpmVTKLMDRWkkldqreypgsetppkyTSALTYDGVLVMAetFRSLRRQKIDISRRGKSGDCLANPAAPWGQGIDMER 347
gi 134024236 268 ntpiVTELMQRWktldqreypgsesppkyTSALTYDGVLVMAeaFRILRRQKIDLSRRGNAGDCLANPAAPWGQGIDMER 347
gi 164419768 268 stpmVTKLMQRWkkldqreypgsetppkyTSALTYDGVLVMAetFRNLRRQKIDISRRGNAGDCLANPAAPWGQGIDMER 347
gi 47550905  263 skpmVIKLMQRWnkldqreypgsesppryTSSLTYDGVLVMAeaFRNLRRQKIDISRRGNAGDCLANPAAPWNQGIDMER 342
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|.
Feature 1                                                           
gi 1346142   348 TLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVL 398
gi 134024236 348 TLKQVRIQGLTGNIQFDHYGRRVNYTMDVLELKSNGLRKIGYWNDMDKLVL 398
gi 164419768 348 TLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKNTGPRKVGYWNDMDKLVL 398
gi 47550905  343 TLKQVRIQGLTGNIQFDHYGRRVNYTMDVFELKSNGPRKIGYWNDLDKLVL 393

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap