Conserved Protein Domain Family
PBP1_iGluR_AMPA_GluR1

?
cd06390: PBP1_iGluR_AMPA_GluR1 
N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR1 subunit of the AMPA receptor
N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR1 subunit of the AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid) receptor. The AMPA receptor is a member of the glutamate-receptor ion channels (iGluRs) which are the major mediators of excitatory synaptic transmission in the central nervous system. AMPA receptors are composed of four types of subunits (GluR1, GluR2, GluR3, and GluR4) which combine to form a tetramer and play an important role in mediating the rapid excitatory synaptic current. Furthermore, this N-terminal domain of the iGluRs has homology with LIVBP, a bacterial periplasmic binding protein, as well as with the structurally related glutamate-binding domain of the G-protein-coupled metabotropic receptors (mGluRs).
Statistics
?
PSSM-Id: 107385
View PSSM: cd06390
Aligned: 4 rows
Threshold Bit Score: 748.304
Threshold Setting Gi: 45387863
Created: 11-Feb-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
putative
Feature 1:putative dimerization interface [polypeptide binding site]
Evidence:
  • Comment:based on sequence similarity to mGluR

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                  # ##  ##                            # 
gi 48994235   26 QIGGLFpnQQSQEHAAFRFALSQLTEPPKLLPQIDIVNISDSFEMTYTFCSQFSKGVYAIFGFYerrtvNMLTSFCGALH 105
gi 157423486  26 QIGGLFpnQQSQEHAAFRFALSQLSEPPKLLPQIDIVNISDSFEMTYTFCSQFSKGVYAIFGFYdrktvNMLTSFCGALH 105
gi 45387863   26 NIGGLFp-TDSHEYDVFRFALSQHNDVPKLVPQVDMVDTGSSFAMTYAFCSQFSKGVYAIIGLYdrktmNMLMSFCGALH 104
gi 122063501  26 QIGGLFpnQQSQEHAAFRFALSQLTEPPKLLPQIDIVNISDSFEMTYRFCSQFSKGVYAIFGFYerrtvNMLTSFCGALH 105
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                              #  #             # #      
gi 48994235  106 VCFITPSFpveTSNQFVLQLRPELQDALISVIEhysWQKFVYIYDADrGLSVLQKVLDTAAEKNWQVTAVNILTTTEegY 185
gi 157423486 106 VCFITPSFpvaTSNQFVLQLRPELQDALISVIEyykWKKFVYIYDADrGLSVLQKVLDTAAEKNWQVTAVNILTTTEegY 185
gi 45387863  105 VCFVTPSFpidTNNQFVIQLRPELQDALIALVEhykWNKFVYMYSSDsGLTVLQKILDTAAEKTWQVTSINFDTLTEaaF 184
gi 122063501 106 VCFITPSFpvdTSNQFVLQLRPELQDALISIIDhykWQKFVYIYDADrGLSVLQKVLDTAAEKNWQVTAVNILTTTEegY 185
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 48994235  186 RVLFQELQKKkerLVVVDCEserLNIILSKIIKLekn-gnGYHYILANMGFmdidlTKFRESGANVTGFQLVNYTdtvPA 264
gi 157423486 186 RLLFQDLDKSkdrQIVIDCEserLNAILTQVVVKlekniiGYHYILANLGFmdidmQKFKEAGANVTGFQLVNYTdtmVS 265
gi 45387863  185 LKAIQDLDNKkefKIILDCElerLNSILNLIAAQkkn-lkNYHYILANLGFldlnlTEFRKGGANVTGFQLMNYTnptVS 263
gi 122063501 186 RMLFQDLEKKkerLVVVDCEserLNAILGQIIKLekn-giGYHYILANLGFmdidlNKFKESGANVTGFQLVNYTdtiPA 264
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 48994235  265 RIMQQWrnndarelprvdwkrpKYTSALTYDGVRVMAeafqnlrRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQV 344
gi 157423486 266 RIMQQWknydgreqprvdwkkpKYTSALTYDGVRVMAeafqslrKQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQV 345
gi 45387863  264 RTIQDWlefdskdl-kspkrrlKYTGALTYDGVTVMAtafqnlrKQRIDISRRGNAGECLANPPAPWGQGIDIQRALQQV 342
gi 122063501 265 KIMQQWknsdardhtrvdwkrpKYTSALTYDGVKVMAeafqslrRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQV 344
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*
Feature 1                                                     
gi 48994235  345 RFEGLSGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDEKLV 389
gi 157423486 346 RLEGLSGNVQFNEKGRRTNYTLHVLELKHEGIRHIAHWNEDDKLI 390
gi 45387863  343 QFEGLTGHVQFNDKGHRTNFTVSVMEFGPSGPKKVGYWNQREKYV 387
gi 122063501 345 RFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFV 389

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap