
Conserved Protein Domain Family

cd06462: Peptidase_S24_S26 
Click on image for an interactive view with Cn3D
The S24, S26 LexA/signal peptidase superfamily contains LexA-related and type I signal peptidase families. The S24 LexA protein domains include: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC, the repressor of genes in the cellular SOS response to DNA damage; MucA and the related UmuD proteins, which are lesion-bypass DNA polymerases, induced in response to mitogenic DNA damage; RulA, a component of the rulAB locus that confers resistance to UV, and RuvA, which is a component of the RuvABC resolvasome that catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. The S26 type I signal peptidase (SPase) family also includes mitochondrial inner membrane protease (IMP)-like members. SPases are essential membrane-bound proteases which function to cleave away the amino-terminal signal peptide from the translocated pre-protein, thus playing a crucial role in the transport of proteins across membranes in all living organisms. All members in this superfamily are unique serine proteases that carry out catalysis using a serine/lysine dyad instead of the prototypical serine/histidine/aspartic acid triad found in most serine proteases.
PSSM-Id: 119396
View PSSM: cd06462
Aligned: 795 rows
Threshold Bit Score: 29.1543
Threshold Setting Gi: 149278479
Created: 8-Jan-2008
Updated: 17-Jan-2013
Aligned Rows:
Catalytic site
Conserved site includes 2 residues -Click on image for an interactive view with Cn3D
Feature 1:Catalytic site [active site]
  • Comment:These serine proteases carry out catalysis using a serine/lysine dyad instead of the prototypical serine/histidine/aspartic acid triad found in most serine proteases.
  • Structure:1T7D: Lipopeptide inhibitor arylomycin A2 blocks the active site of Escherichia coli type I signal peptidase
    View structure with Cn3D
  • Structure:1B12: A beta-lactam inhibitor, (5S,6S)-penem, blocks the active site of Escherichia coli type I signal peptidase
    View structure with Cn3D
  • Citation:PMID 982390

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
Feature 1                #                                                       #               
1JHF_A       111 FLLRVSGMSMkdigimDGDLLAVHktqd----------------vrnGQVVVARIdd---eVTVKRLKkqg--------- 162
1T7D_A         9 EPFQIPSGSMmpt-llIGDFILVEkfaygikdpiyqktlietghpkrGDIVVFKYpedpklDYIKRAVglpgdkvtydpv 87
gi 120602096 152 VCVRVSQDSMapl-lhVGDYVIIDradcvv------------teqghGNIFLVNDpq--dgPTIKRARiqstp------- 209
gi 187596455 198 VVLRVAGDSMepd-yqAGERVLVDtahr---------------tpspPGVYVLWDgf---gLVLKRLEivygse------ 252
gi 144900044 132 RIMHVEGDSMmpt-lhSGDVVLVDlskrl--------------ptppGIFVLFDGm----gLVAKRLEhipnh------- 185
gi 46201984  140 RMITITGDSMepl-lsSGDRILIDtsqkv--------------pvppGIFVIWDGm----gLVTKRIEhiphs------- 193
gi 163792598 153 KIISIDGDSMepv-lsAGDKVLIDtsrv----------------apsPPGIFVLHdg--lgLVAKQVEyvpnt------- 206
gi 148557717 129 SIIRVAGESMept-lhDGDDILVDrdas---------------eirpGGIYVLRLdd---lLMVKRLLrdd--------- 180
gi 94495894  131 SIIRVDGESMapt-lsDGDDIMVDhddda--------------drlrDGVYVLRLdg---vLMVKRIAmgpl-------- 184
gi 85372990  121 SIVGVKGDSMept-lsDGDEVLVDasdhg--------------srlrDGIYVLRSdd---aLVVKRIAikpg-------- 174
                         90       100       110       120       130       140       150       160
Feature 1                                                                                        
1JHF_A           --------------------------------------------------------------------------------
1T7D_A        88 skeltiqpgcssgqacenalpvtysnvepsdfvqtfsrrnggeatsgffevpknetkengirlserketlgdvthriltv 167
gi 120602096     --------------------------------------------------------------------------------
gi 187596455     --------------------------------------------------------------------------------
gi 144900044     --------------------------------------------------------------------------------
gi 46201984      --------------------------------------------------------------------------------
gi 163792598     --------------------------------------------------------------------------------
gi 148557717     --------------------------------------------------------------------------------
gi 94495894      --------------------------------------------------------------------------------
gi 85372990      --------------------------------------------------------------------------------
                        170       180       190       200       210
Feature 1                                                                   
1JHF_A       163 -------------------------nkvELLPEn-sEFKPIVVdlr---qqsFTIEGLA 192
1T7D_A       168 piaqdqvgmyyqqpgqqlatwivppgqyFMMGDnrdNSADSRYwgf---vpeANLVGRA 223
gi 120602096 210 -----------------------tstvlFCYCDn-vRIPPSFIqipqdddnyLSHGVLG 244
gi 187596455 253 -----------------------dpvsvQIMSIn-pGYPTYTRa--------LDEVHIN 279
gi 144900044 186 -----------------------dppkvRVISDn-tFYTPYERt--------ADEVNII 212
gi 46201984  194 -----------------------dpptvVIRSIn-pEYQTYERt--------ADEINII 220
gi 163792598 207 -----------------------dpptlVIKSAn-sRYQDYERt--------VDEVTIA 233
gi 148557717 181 -------------------------rglVVHSDn-pAHPEIAGf-------dPATLQVI 206
gi 94495894  185 ------------------------rgrfSVLSDn-aHYPDWTDi-------dPTLVDIV 211
gi 85372990  175 ------------------------grqiTIASDn-pAYPTWHDm-------dRSEVHVV 201

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap