Conserved Protein Domain Family
CIDE_N_B

?
cd06537: CIDE_N_B 
Click on image for an interactive view with Cn3D
CIDE_N domain of CIDE-B proteins. The CIDE_N (cell death-inducing DFF45-like effector, N-terminal) domain is found at the N-terminus of the CIDE (cell death-inducing DFF45-like effector) proteins. These proteins are associated with the chromatin condensation and DNA fragmentation events of apoptosis; the CIDE_N domain is thought to regulate the activity of the CAD/DFF40, ICAD/DFF45 and CIDE nucleases during apoptosis. The CIDE protein family includes 3 members: CIDE-A, CIDE-B, and FSP27(CIDE-C). Based on sequence similarity with DFF40 and DFF45, CIDE proteins were initially characterized as mitochondrial activators of apoptosis. However, strong metabolic phenotypes of mice lacking CIDE-A and CIDE-B indicated that this family may play critical roles in energy balance.
Statistics
?
PSSM-Id: 119370
View PSSM: cd06537
Aligned: 4 rows
Threshold Bit Score: 155.844
Threshold Setting Gi: 49256140
Created: 21-Feb-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
putative
Conserved site includes 14 residues -Click on image for an interactive view with Cn3D
Feature 1:putative heterodimer interaction sites [polypeptide binding site]
Evidence:
  • Comment:Based on the CAD / ICAD CIDE_N domains.
  • Comment:Although the CAD and ICAD CIDE-N domains are structurally similar, they bind one another asymetrically using different surfaces from each protein.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1             #        ## ##         #   #             # ##    ##                  # #   
1D4B_A        34 PQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRS 113
gi 49256140   34 AQRPFRVCNHDRTVRRGVTAGSLRELIARAMDVLFLSGVVSLVLEDDGTLLDREDFFETLEDGSVVMVLEKGQKWSPQKN 113
gi 149064009  79 PQRPFRVCDHKRTVRKGLTAATRQELLDKVVETLLLSGVLTLVLEEDGTAVETEDFFELLEDDTCLMALEQGQSWSPKSG 158
gi 162138890  34 PQRPFRVCDHKRTVRKGLTAASLQELLDKVLETLLLRGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLEQGQSWSPKSG 113

                 .
Feature 1         
1D4B_A       114 G 114
gi 49256140  114 I 114
gi 149064009 159 M 159
gi 162138890 114 M 114

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap