Conserved Protein Domain Family
GH18_trifunctional

?
cd06549: GH18_trifunctional 
GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
Statistics
?
PSSM-Id: 119366
View PSSM: cd06549
Aligned: 8 rows
Threshold Bit Score: 345.165
Threshold Setting Gi: 169826146
Created: 5-Aug-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
putative active
Feature 1:putative active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1            #                                               #                            
gi 56551550    94 LSMAFYtpw------ddaSIASLSRHin---------------dIDWLSPGWLSvtgadhhw------------------ 134
gi 86139993   119 EQPVFSama------esaSTPRLYAHlpiayewahlsladecarPSVLVPEWITleveknilsvs--------------- 177
gi 87199612    85 LAIGFYqpr------sdaSFQSLSRHgn---------------qLDWVVPALLNvagpehrl------------------ 125
gi 167644200   99 ISVGFYvsw------dedSRESLRRNid---------------kLDVVSPQWVAlkgpagdi------------------ 139
gi 148555662   99 TAYAFHapw------ddaSAASLARHvd---------------dIDWLIPGWISitgpdhkv------------------ 139
gi 94967428    93 IRAAFYvdw------daaSFSSLKQYyp---------------qIDLLFPEFLHvltedghiqgvtaenkl-------fd 144
gi 169826146   13 IALLFItacsnskeppaiAKEELKDKak--------------lrLSMWLPEWQNqsaledvqnsqqglqdmrvfgayfnh 78
gi 163698578   90 QALRFAylas-----ndyALASLKQHaa---------------eLDGIIPDWLElrqqegri------------------ 131
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        #
gi 56551550   135 -------tefpdpqGHAIINNAkqkPKILPMVQNvsngewdgkn-----aailmrdpaARLQFLNNIEKFlvknqADGAV 202
gi 86139993   178 ----lasddtrlavTEYVAETEratSLLPVVSLNisgipdhf--------vdllveknSKAAIIASLAETltalsAQGAC 245
gi 87199612   126 -------avsndprFDSFVAAGhhhYKVLPMVQNvggdgwdgan-----varilenatERHALERQLADYvarrgDAGLV 193
gi 167644200  140 -------vvdddpqGVARIAAApnhPAVLPLVHNsanaafngpl-----adalladpkARAKLIASLADLavkrgYGGYV 207
gi 148555662  140 -------tsfpdarGKAIISHAhrrPKLMPMIQNalggawdgpg-----iaallrdpkARAATLDRVAALlaanqASGVF 207
gi 94967428   145 vmdasgkvrpvddkLMPYLKAEkaeTEVFPLVNNfdpianewks----digdflddpaSRANFRKQIDAFlgsdrYRGLT 220
gi 169826146   79 kdellltdnavdmlRQTQQQFNeshHVILTLINDyvtdnassvqkdstllhrlvqdssARKKHINNILQVveqyqPDGIE 158
gi 163698578  132 -------hiqvddnSVGISRWLkanAPRLQIYPLinsgltthq------tnlvfamnsAREKSIAEIISYlerneLPGIT 198
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1          # #                                                      # ##                  
gi 56551550   203 FDFESLnkqtlpfYLQLLKETHDRFsah-hwILTVAVPvadeawnlsavanVSDKLILMAYDehypegepGAIASNDWFl 281
gi 86139993   246 LDFNTLkvndmqrLAPFWSELTTQFrtnglvSCIVLNPeqtlwq-qpdliqDFDQVILKMFQipwvgsapMPLASDQWFe 324
gi 87199612   194 LDFEDLpatamrpYVAFLRETNALLpa--gaQLAVTAPageddwpiaalgrAADKVILMAYDehwqngaaGPIASQTWFt 271
gi 167644200  208 FDLESLsakglvnYPKLLDEARAALkpq-grEVWVTAPfdeegwplkrlqdSSDTLVLMAYDqhyafgdpGPNAGQDWYe 286
gi 148555662  208 FDFEELpadahpaYRAFLTEARRRLpg---mQIAIAVPvadatwdlkayarVADKLFLMAYDehsepgdpGPIASRPWFa 284
gi 94967428   221 LDFEEIpvdsmpgFEALVSEIYQDMhas-gkKLYISVPakntdfnyeavakNSDGLILMNYDehypggpaGAVASQDWFv 299
gi 169826146  159 IDYEKIakedlskYVQFLKELYRELak---kNVTLHVVlepsfp-fdvklpNGPSYTVMAYNvhg--yhsGPGAKATFSf 232
gi 163698578  199 LQVPNAtpsneriIINFVRELRRRLgeqqrkLIVMTSLtdgapr--iselsKASDYVLVTTHdntqygrpTPIVPQAWIe 276
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 56551550   282 dvveqatqnlppekVIVALGSYAYNWkkgsdtdaisieqawl-------tahesgtvpvfdketGNTHFSYse-aGILHN 353
gi 86139993   325 ktlsqavkgieperLVVALGNFAVDWtsgtalpetlsysaavq-----rigeaeaevlfsprtsNSFSRFTds-eGTLHK 398
gi 87199612   272 neveksaralpadrLVIALGSYGYDWhqggtdalslsdawl--------aahdshapiifdkasGNAGFAYeq-dGVSHT 342
gi 167644200  287 selakrfakldparTIMALGAYGYDWtlnkngkpasgspatfhea-mrnaqdagatidmdddalNPTYDYVdd-nGDSHV 364
gi 148555662  285 dsvaravrglppdrVVVALGSYAYDWekggdtiahsvedvwl-------aahdsgvvprfdpasGNSSFAYle-gGVRHD 356
gi 94967428   300 enlkfavkhvprekIICAISNYGYEWttignaklpqtahtvstqeawttaeesdadveldgdalNPHITFMeg-eNARHD 378
gi 169826146  233 lndliknikksnqkLAIAFATGGFDWvaqgntvalteleaek-------vlaetnakkqrdkasGAVYFTYtdtsNMSHE 305
gi 163698578  277 sqlaalfaradaskIIVSIGSFGIDWdrfgrmkqisvpaawt------lmqnagtplkfdqrslNATLRYRda-nGQPHE 349
                         330       340       350
                  ....*....|....*....|....*....|....*..
Feature 1                                   #          
gi 56551550   354 VWMLDAVSFYNQTKMSHHLGFNALALWRLGSEDPSLW 390
gi 86139993   399 IWMLDAASAHNQLAVVRQLGLANVAVWSMGQEDPGLW 435
gi 87199612   343 VWMLDAATDWNEMLAVQRLGIGNLALWRLGTEDPGFW 379
gi 167644200  365 VWFLDATTLFNQVKVTDAWKPRGYGLWRMGMEDPGVW 401
gi 148555662  357 IWLLDAAAMHGQIATLRTLGLHQVALWRLGTEDPSVW 393
gi 94967428   379 VWFTDGVTALNQMRAAQQLGIDTFALWRLGSEDRSLW 415
gi 169826146  306 IWYADQETLEKWVKYVQRKSYHDVVLWRAGGLGVKTL 342
gi 163698578  350 VWLLDGVTCFNQLRAVLAYKPAGIALFGLGYEDAGIW 386

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap