1FC7,1N6E,1J7X,3DJA


Conserved Protein Domain Family
Peptidase_S41

?
cd06567: Peptidase_S41 
Click on image for an interactive view with Cn3D
C-terminal processing peptidase family S41
Peptidase family S41 (C-terminal processing peptidase or CTPase family) contains very different subfamilies; it includes photosystem II D1 C-terminal processing protease (CTPase), interphotoreceptor retinoid-binding protein IRBP and tricorn protease (TRI). CTPase and TRI both contain the PDZ domain while IRBP, although being very similar to the tail-specific protease domain, lacks the PDZ insertion domain and hydrolytic activity. These serine proteases have distinctly different active sites: in CTPase, the active site consists of a serine/lysine catalytic dyad while in tricorn core protease, it is a tetrad (serine, histidine, serine, glutamate). CPases with different substrate specificities in different species include processing of D1 protein of the photosystem II reaction center in higher plants and cleavage of a peptide of 11 residues from the precursor form of penicillin-binding protein; and others such as tricorn protease (TRI) act as a carboxypeptidase, involved in the degradation of proteasomal products. CTPase homolog IRBP, secreted by photoreceptors into the interphotoreceptor matrix, having arisen in the early evolution of the vertebrate eye, promotes the release of all-trans retinol from photoreceptors and facilitates its delivery to the retinal pigment epithelium.
Statistics
?
PSSM-Id: 143475
View PSSM: cd06567
Aligned: 491 rows
Threshold Bit Score: 84.269
Threshold Setting Gi: 188587087
Created: 8-Jan-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
Active site
Conserved site include 1 residue -Click on image for an interactive view with Cn3D
Feature 1:Active site serine [active site]
Evidence:
  • Structure:1FC7: Scenedesmus obliquus Photosystem II D1 C-terminal processing protease (D1P)
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1FC7_A         9 FLEAWRAVDRayvdks------fngqsWFKLRETylkke-pmdrRAQTYDAIRKLLavlddpFTRFLEpsrlaalrrgta 81
gi 149178016 228 FDKVWNAFDReyamfv-----ikpevdWQKLRDQfrpqavlaknNRELANVLSEMLahlkdlHVYVQVdgtyvkgfnrer 302
gi 226226479  46 FDALWTRFDDvypsfa------ykrvdWNAQRARyrpraerarsQDELVAVLIEMLaplhdrHVWLVDprgqavptyran 119
gi 88711162  358 LFKYWNIVNYfspnkh------ltdknWDEVLTEyipkfidsknELEYELTTLKLIgeisdsHARIGLggqkindlrgny 431
gi 127514729 354 LYRYWNIVQYffpyky------ltdkeWSGVLAEylplflgaknRLDYEKVTLSLIaelkdtHANLWAgrgevekmrgef 427
gi 163755089 359 LYRYWNMIHYyfpyky------ltdkdWSTVLKEyiptfinastELEYEIAALRLIgdiqdtHAGLWGgndkfqailgsn 432
gi 116620719 357 LFRYWNIIEYwfpnrd------iigenWDDVLKQtlpkivlakdRDTYQLEMMALIarihdsHANLWSslalrppvgacq 430
gi 34541270   36 YDALWEILDRgycffdlklpedstwrdMYHKHYRdlhp---qmsSDSLFLVMTQLLselkdgHVNLSSsfdyghywkwye 112
gi 150009779  33 FEALWKILDEnycffey----kdidwnEVHDRYKtqis--dtmnQYVLFDVLGDMLnelkdgHTNLIStfnmsrywdwyl 106
gi 110639714  37 FEYLWKQCDEkysffei----nnidwnAIHDTYRaqit--dgmsKEDQFIVMGNMLnelkdgHVNLLSdfnisdyhfdwk 110
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1FC7_A        82 gsvtgvgleitydggsgkdvvvltpapggpaekagaragdvivtvdgtavkgls---------lydvsdllqgeadsqve 152
gi 149178016 303 qfnaspaaa----------------------------------------------------------------------- 311
gi 226226479 120 altnfdrarw---------------------------------------------------------------------- 129
gi 88711162  432 yppfevrfiqgklvvtnyhnpelikesgleigdvithiqeravesvidslkpyyp-------asndaarmrdisldilrs 504
gi 127514729 428 yppvftrfvegelvvvdfytdnesnisdmsrlgglsigdviteidgvaveklvkdklryypasneasrlrdiapdllrsn 507
gi 163755089 433 tapfkvafvenklvvtkyynpeykevskvkigdvithingktveeikkerhdy----------hpasneptkdrnmaksm 502
gi 116620719 431 lpvnlrfvenqavvtgysaeamentsglkvgdviadldgvpvaklvqtwtpyya---------asneptrlrdiarsmtr 501
gi 34541270  113 dyplnlsldlrrky------------------------------------------------------------------ 126
gi 150009779 107 dypdnfdsdiq--------------------------------------------------------------------- 117
gi 110639714 111 gpqnitprvvye-------------------------------------------------------------------- 122
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1FC7_A       153 vvlhapgapsntrtlqltrqkvtinpvtfttcsnvaaaalppgaakqqLGYVRLatfn-----sntTAAAQQAFTelskq 227
gi 149178016 312 ---------------------------ahligkinqvkgmrwgrteddIGYIAVdslsketllnqfESALKQMQGt---- 360
gi 226226479 130 --------------------------eaamrdasivrrneigeglvggYAYLYIgtwrapvdidalDLALERARDa---- 179
gi 88711162  505 reknlsigyisedkkiqeviklfpkdsldivrwdvsdgkpshkfiddnIGYITLrsle----kkdiENIKTKFRNt---- 576
gi 127514729 508 kaeidisfrrdklmgntslklfkkdeldyfylyrkpkgeksyknidgdIGYVTLatie----kedvDSIKNQFKDa---- 579
gi 163755089 503 lrspnkeiaityvsdgktqqhtlplygfrdlniyaksnkasyklldnnIGYVTLetis----vddiSKIKKQFKKt---- 574
gi 116620719 502 gecgaaklrvfrgtqevtlqsdrvplgslkfssshdrpgetyqrlsseVAYIKMssik----nvdiPRYIDSAAGt---- 573
gi 34541270  127 -----------------------lghdyriagglkyrrltynghapdsIGYIVYesfgkp-isnsnISGMLSRLTec--- 179
gi 150009779 118 -------------------------enylgrnysiagglkyttlsdgqIGYIYYgsfsss-agesgLDHIFYQFKdc--- 168
gi 110639714 123 -------------------------hyigqdgylnspfqhnfvgggtdVGYIIFstfpgt-mtddqIDFILNRYKdt--- 173
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
1FC7_A       228 gvaGLVLDIRn--NGGGlf----paGVNVARMLvdrgdlvliadsqgi----------rdiysadgnsidsatPLVVLVN 291
gi 149178016 361 --rGLVLDIRa--NGGGaeplgqkmAGYFLDQPclyathqyrsgpkhddlg-----smqkrrlipsqdwyyrgPVIVLQG 431
gi 226226479 180 --qGLIIDLRt--NAGGsd----gtAMAFAGRFtrrafpasyveirtdprvtd-vemplartiaprgpwqftrPVVLITG 250
gi 88711162  577 --kGIIIDIRnypNTFVpy----slGPYFVSSTrpfvkltaanidnpgei------cfvkelevpksndaysgKLIVLVN 644
gi 127514729 580 --aGIIIDIRnypNTPSmy----slGSFFVEDKsafakftypninnpgef------gvgnvavlkpsevtfkgKLVVLVN 647
gi 163755089 575 --kGIIIDIRn--YPAEsil--yylGSYFVSEPtefvkfsrmneknpgef------vmteayeisksrsmykgKLVVLVN 642
gi 116620719 574 --kGLIIDIRn--YPSDfvv--ftlGQLLVTEKtefvrftsgdlanpgaf------hwgpplalnpqkphyagKVVILVD 641
gi 34541270  180 --kALIIDIRg--NGGGql----tyADEFARHFtkekmltgyirhktgpahdafsdplplyldtlssgvvwmrPVVLLTN 251
gi 150009779 169 --kGLIFDIRd--NGGGml----snADRIASRFleekiltgyiqhktgkghdd-fsepyplylspserirwlrPVVVLTN 239
gi 110639714 174 --kGLIIDVRq--NGGGaa----tdMTRLVSHFmgsestvyrtrikegkghnd-ftaledikikpsdgtkytkPVYLLTD 244
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
Feature 1            #                                                                       
1FC7_A       292 rgtaSASEVLAGALKDskRGLIAGERTFGKGliQTVVDls-dGSGVAVt-vARYQTPagvdinkiGVSPD--VQLD 363
gi 149178016 432 ektmSSAEAFALMLAEcpTVTTMGDRTAGSSg-NPRRIdagaGIIVNLp-rWIAYDAagkpfdtvGVQPD--IRVK 503
gi 226226479 251 rgglSATESFAAAMRTlpQVTVIGDTTGGASg-NPATFalgnGWQFTVp-rWLEYGPdrqpiegrGVAPH--LAMA 322
gi 88711162  645 eysqSQSEFTCMALRVgdNTTIVGSTTAGADg-NVSSIslpgGISTRIs-gMGIYYPdgtetqrvGIEPD--VESK 716
gi 127514729 648 entqSQAEFTAMAFRAgrDTTIIGSKTSGADg-NMVRLdl-pGGLRTAfsgLGVYYPdggetqrvGIIPD--IEVR 719
gi 163755089 643 easqSHAEFTAMAFRAgeNTTIVGSTTAGADg-NVSTImlpgGLRTSIs-gIGVYYPdggetqriGIVPD--VEVK 714
gi 116620719 642 evsqSNAEYTTMAFRSatGATVIGSTTAGADg-NVSQIpl-pGGLSTMisgIGVFYPdkrptqrvGIVPD--IEVK 713
gi 34541270  252 revfSSANDFVLKMRSlpFVTVMGDKTGGGAglPISSEip-cGWGVRYs-aGRMTDPsgad-vefGIEPHyyVSLL 324
gi 150009779 240 rhcySAANDFVQKVRMmpYVTTMGDRTGGGSgfPFNSElp-nGWGVRFs-aSPMLDVnkqh-tefGIDPT--YKVS 310
gi 110639714 245 rgtfSSGSFFTTAMRSlpHVTVMGDTTGGGMglPNGGQlp-nGWTYRFs-vTQTWDMdgnl-yenGIPPDv-LKFI 316

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap