Conserved Protein Domain Family
GH20_chitobiase-like_1

?
cd06570: GH20_chitobiase-like_1 
A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
Statistics
?
PSSM-Id: 119338
View PSSM: cd06570
Aligned: 9 rows
Threshold Bit Score: 531.602
Threshold Setting Gi: 37676801
Created: 22-Aug-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
active site
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                   #                                                                    
gi 54308461  166 FPWRGALIDTSRHFIPVDVIKRQIDGLASAKFNTFHWHLTDDQGWRIESLAYPNLHekgsdGLYYTREQMKDVVAYAKNL 245
gi 86134736  132 FVWRGLMIDVSRHFQPIDVIKRNLEAMASVKMNVFHWHLTDDQGFRIESKVYPKLQefasdGLFYTQNQIKDVVAFANNL 211
gi 58039050  170 FAWRGLLMDVSRHFDTVETIERQLDAMELVKLNVLHWHLSDGAGFRVESRMFPKLQtvashGQYYTQAQIREVVAYAADR 249
gi 37676801  165 FKWRGVSYDTARHYIELPVILRQLDAMASAKMNVFHWHIWDDQGIRIQLENYPRLWqatadGDFYSKDEIRQVVEYARNL 244
gi 88859502  156 YPWRGLLFDGVRHFLPIDDVKRTLRGLASAKFNVFHWHLTDDQGWRIELNSYPKLHqtasdGLYYTQAQIKEVVAYAAQL 235
gi 116625620 155 FPWRGLMLDSARHFMPLAVVKRNLDAMAAVKLNVFHWHLSEDQGFRVESKRYPKLQekgsdGLFYTQSEIRDIVSYARDR 234
gi 182412827 163 FPWRGLMIDVCRHWQPMEVLKRNLDGMALVKLNVLHLHLTEDQGFRIESKTHPRLHelgsdGLYFTQDQIREIIAYAAAR 242
gi 192361103 158 FIWRGLLLDSSRHFFSVASIKRQLDIMAAAKFNLFHWHLTDDQGWRLESKKFPRLQqfasdGQYYTREQVRDIVAYARDR 237
gi 94969762  167 FPWRGLLIDSGHRFVPVAAVKRNLDGMEAVKLNVLHWRFADDQGFHIESKKLPLLQqkasgGLYYTQEEVREVIAYARDR 246
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                    #                                                                ## 
gi 54308461  246 GIRVIPEVDLPGHASAIAAAYPELmtevkeykie--rkwgvheplLDPTKPEVYTFIDKIIGEVAELFpDEYIHIGGDEV 323
gi 86134736  212 GIRVIPEIDVPGHASAILTAYPELgskdnytysi-erfagvfdptLDPSKEITYTFLENLFTEITPLFpDEYFHIGGDEN 290
gi 58039050  250 GIRVVPEIDVPGHALAILQAYPELaaqplpdvta--kglnlnnaaLDPTNPQTLRFVRVLYGEMGGLFpDRYVHTGGDEV 327
gi 37676801  245 GIRVIPEISLPGHASAVAHAYPELmsglgeqsypqqrgwgvfeplMDPTNPELYTMLASVFDEVVELFpDEYFHIGGDEP 324
gi 88859502  236 GIRVVPEFDVPGHASAIILAYPELgsgtvlseme--rhwgvfkplLDPSNPKVYLFVDEVVDELAGLFpDPYLHIGGDEV 313
gi 116625620 235 GIRVVPEFDIPGHTTAWMVGYPELgtvpgpyeig--rkwgvyenaLDPSREETYTFLDNFFEEITPLFaDLYFHIGGDEV 312
gi 182412827 243 GIRVVPEFDMPGHATSWAVAYPELasapgpyvie--rgwgifdpvLDPTNEKVYALLEDFLGEMAALFpDPYLHIGGDEN 320
gi 192361103 238 GIHVLPEIDIPGHASAIAVAYPELmsapgpyame--yrwgvhkptLNPANERVYEFVDQLIAEVVELFpFDYVHIGGDEV 315
gi 94969762  247 GIRVMPEFDMPCHTRSWFLAYPELasrga-----------adsagFDPSKESTYKLLATFIGEMAALFpDAYFHTGGDEC 315
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                       #                #               
gi 54308461  324 npkqWNESKAVQTFMAEKGLkdaLELHAFFNQEVEEILKKhdrKMIGWDEtyhpdlpksIVIQSWRgh-------dsLGE 396
gi 86134736  291 egkhWSENEEIKKFKEKHQLknnHELQTHFNIRLEKILNKlgkKLMGWDEiltpnmpttAVIHSWRgenegvanggsLIE 370
gi 58039050  328 vssqWTKNPAIAAYMKAHGFetaAALQAAFTGEVAKIISAqghVMMGWDEvseapipknVVVEPWRas-------kwTGT 400
gi 37676801  325 nyqqWRDNPKIQAFIKQHQLdgeRGLQSYLNSRVEQMLNQrgkKITGWDEiwhkdlpksVVIQSWQgh-------dsIGR 397
gi 88859502  314 ddsdWQTNSQIQAYMQTNNLsdsYALHAYFNQRVATILAKyhkKMIGWDEvlhpslpknTLVQSWRgh-------hsLTA 386
gi 116625620 313 varqWNASARVQAWAKEHNLkdaHAIQAYFNTRVQKLLQKrgkVLIGWDEvlhpdlpkdIVVQSWRgq-------ksLAE 385
gi 182412827 321 ngkhWNANARIQAFIREHDLkdnEGLHATFNRRVRDILTKhgkKMVGWDEilhpdlpqdAIVHSWRgp-------tgLAA 393
gi 192361103 316 dpqhWQENADIQAFMQANGLvdhLALQAYFNQRVQKILSQhkrNMIGWDEiqhpdlpnnIVIHSWQgp-------dgVSN 388
gi 94969762  316 dpkeWESNPRIAQYMREHKFangAALQAMFTGRVEKIVAAnkkIMVGWDEvlqpntpkdVVIQSWRgq-------asLAD 388
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                      # #                                                               
gi 54308461  397 SANDGYQGILSTGyYIDQAqpAAMHYRNDPMpkplqvddevhtdeswetwqfeaprkrgsavtgtftlitakdgtrrgfi 476
gi 86134736  371 AAKKGYQTVLSNGfYIDRMlsVEHHYAVDPIgdikls------------------------------------------- 407
gi 58039050  401 ATQAGHPVVVSAGyYLDLLrpSAAHYAVDPFdtkaegitaeqlakyppkhpe---------------------------- 452
gi 37676801  398 AAKEGYQGILSTGyYLDQPqpTSYHYRNDPMpkgitvddqlhqgekfvtydwvkprnkggprkgnltiiegadgkvraft 477
gi 88859502  387 IREAGFDGLLSSGfYIDQPqwTSYHYRNHPVpaptkkvvahklkgsvnftltrlkgspvtgqvdvftnhhnaifarveik 466
gi 116625620 386 AATKGYRGILSWGyYLDHLspAKFHYGVDPMssdadkl------------------------------------------ 423
gi 182412827 394 AAKAGHAAILSNGyYIDLCysAADHYRNDPLpadtaip------------------------------------------ 431
gi 192361103 389 AIRHGFNAILSTGyYLDQPqtAAYHYRQDPLpqppfridapavgeswqswsftlprqrgrpvsgsftllddgkqtrgfid 468
gi 94969762  389 AAREGYRGVLSWGyYIDLNqsAAEHYQVDPMgdaaakl------------------------------------------ 426
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 54308461  477 dyksrsrravfdiettqgi-----tsfwmdswmgqtkprvelqggkltghmvvgnaqyvmtgqkiagndiqnsqyptapy 551
gi 86134736      --------------------------------------------------------------------------------
gi 58039050  453 ----------------------------------------------------------------------fsvpfamdeh 462
gi 37676801  478 dyngksreevyvleyvpgvmfrghfdnfmsytefnyqfagdqlkegsyqrignvrwpatgnlvassegevtsipqpnggy 557
gi 88859502  467 gkgqfishnvkqtag-------------vyqitldtwmgpttlrfalgqnsqldaligntpytfaaqanttslehlntll 533
gi 116625620     --------------------------------------------------------------------------------
gi 182412827     --------------------------------------------------------------------------------
gi 192361103 469 fagksrrevkvhrytknr------aqfsldtwmgpvefdvnmdqrlggkawvgnvaypvsgkqiagsnhaqtglpepqva 542
gi 94969762      --------------------------------------------------------------------------------
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                           # #                                      
gi 54308461  552 pvalkkeqehlILGGEVTLWAEnvkdDTIDLRMWPRSYVIAERLWSaetitDENSMYERM 611
gi 86134736  408 -----keelskILGGEATMWSElvtpQTIDSRIWPRTAAIAERLWStkdvkDIDNMKKRL 462
gi 58039050  463 applddgqkalVMGAEGTLWAEmvsePMLDGRLWPRMAALAERFWSaqdvrDVPDLERRL 522
gi 37676801  558 paqltkeeeplILGGEVTIWGEnldsMTIEQRLWPRSYAIAERLWSsesltDEASMYRRM 617
gi 88859502  534 iaeqqreqtgnVLGGEATIWSElittENLDTRLWPRLYAIAERFWSspsltNERDMYQRL 593
gi 116625620 424 ----apeqasrILGGEACMWAEyttsETVDSRIWPRAAVIAERLWSpaatvDVESMYTRM 479
gi 182412827 432 -----laeqsrILGGEATMWAEwvspETIDSRIWPRTAAIAERLWSprdvnDVADMYRRL 486
gi 192361103 543 pyvlraedyarVLGGEVALWSElvdeGTLDLRLWPRALAVAERLWSaqdrrDEVDLYQRL 602
gi 94969762  427 ----tpeqqarILGGEATMWTDivshENMDNRIWPRTAAIAERFWSpqevrDLDSMYARL 482

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap