3GGF,4FZA


Conserved Protein Domain Family
STKc_MST4

?
cd06640: STKc_MST4 
Click on image for an interactive view with Cn3D
Catalytic domain of the Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4
STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by interacting with the Golgi matrix protein GM130 and may play a role in cell migration. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 132971
View PSSM: cd06640
Aligned: 5 rows
Threshold Bit Score: 523.076
Threshold Setting Gi: 148223449
Created: 15-Nov-2007
Updated: 2-Mar-2014
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 21 residues -Click on image for an interactive view with Cn3D
Feature 1:ATP binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                   #####   #            # #                #            #               
3GGF_A        20 DPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGsKLWII 99
gi 71895433   19 DPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKGtKLWII 98
gi 148223449  19 DPEELFTKLERIGKGSFGEVFKGIDHRTQHVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKGtKLWII 98
gi 47215372    1 DPEELFTKLDRIGKGSFGEVFKGIDNRTQSVVAIKTIDLEEAEDEIEDIQQEITVLSQCDSPYITKYYGSYLKGtKLWII 80
4FZA_B         5 DPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGsKLWII 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        ####  ##  #                                      ## #          #                
3GGF_A       100 MEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEqGDVKLADFGVAGQLTDTQIKRNT 179
gi 71895433   99 MEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEqGDVKLADFGVAGQLTDTQIKRNT 178
gi 148223449  99 MEYLGGGSALDLLRVGPFDEFQIATMLKEILKGLDYLHSENKIHRDIKAANVLLSEqGDVKLADFGVAGQLTDTQIKRNT 178
gi 47215372   81 MEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEhGQVKLADFGVAGQLTDTQIKRET 160
4FZA_B        85 MEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEqGDVKLAAFGVAGQLTDTQIKRNT 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
3GGF_A       180 FVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKnNPPTLVGDFTKSFKEFIDACLNKD 259
gi 71895433  179 FVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKnNPPTLLGEFSKPFKEFIDACLNKD 258
gi 148223449 179 FVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKnNPPSLAGDFSKPFKEFIDACLNKD 258
gi 47215372  161 FVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFHIPKfPAPTLTGEFSRNFKEFTEACLNKD 240
4FZA_B       165 FVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKnNPPTLVGDFTKSFKEFIDACLNKD 244
                        250       260       270
                 ....*....|....*....|....*....|....*..
Feature 1                                             
3GGF_A       260 PSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWK 296
gi 71895433  259 PTFRPTAKELLKHKFIMKNAKKTSYLTELIDRFKRWK 295
gi 148223449 259 PSFRPTARELLKHKYIVKNAKRTSYLTELIDRFKRWK 295
gi 47215372  241 PAFRPTAKELLKHKFIVKHCKKTSYLSELIDRYRRWK 277
4FZA_B       245 PSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWK 281

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap