2F57


Conserved Protein Domain Family
STKc_PAK5

?
cd06658: STKc_PAK5 
Click on image for an interactive view with Cn3D
Catalytic domain of the Serine/Threonine Kinase, p21-activated kinase 5
STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. PAK5 is mainly expressed in the brain. It is not required for viability, but together with PAK6, it is required for normal levels of locomotion and activity, and for learning and memory. PAK5 cooperates with Inca (induced in neural crest by AP2) in the regulation of cell adhesion and cytoskeletal organization in the embryo and in neural crest cells during craniofacial development. PAK5 may also play a role in controlling the signaling of Raf-1, an effector of Ras, at the mitochondria. PAK5 belongs to the group II PAKs, which contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 132989
View PSSM: cd06658
Aligned: 3 rows
Threshold Bit Score: 578.531
Threshold Setting Gi: 313661446
Created: 16-Nov-2007
Updated: 2-Mar-2014
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 23 residues -Click on image for an interactive view with Cn3D
Feature 1:ATP binding site [chemical binding site]
Evidence:
  • Structure:2F57; Human PAK5 binds the purine-based inhibitor Lopac-C-3353; defined at 4A contacts.
    View structure with Cn3D
  • Comment:Also based on the structure of human PAK4 bound to purine-based inhibitor that mimics the binding of ATP, and on the binding of other related proteins with structure to ATP or inhibitors.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                     #####   #            # #                           
2F57_B        24 RVSHEQFRAALQLVVSPGDPREYLANFIKIGEGSTGIVCIATEKHTGKQVAVKKMDLRKQQRRELLFNEVVIMRDYHHDN 103
gi 45751665  418 RVSHEQFRAALQLVVEPGDPRQGLDSFLKIGEGSTGIVCIATEKHSGKQVAVKKMDLRKQQRRELLFNEVVIMRDYHHEN 497
gi 313661446 430 RVSHEQFRAALQLVVSPGDPREYLDSFIKIGEGSTGVVCIATEKHTGKQVAVKKMDLRKQQRRELLFNEVVIMRDYHHEN 509
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1         #               ##### ##  #                                      ## #         #
2F57_B       104 VVDMYSSYLVGDELWVVMEFLEGGALTDIVTHtRMNEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLS 183
gi 45751665  498 VVDMYNSYLVGDELWVVMEFLEGGALTDIVTHtRMNEEQIATVCLSVLKALSYLHTQGVIHRDIKSDSILLTSDGRIKLS 577
gi 313661446 510 VVDMYNSYLVSDELWVVMEFLEGGALTDIVTHtRMNEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLS 589
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1        #                                                                               
2F57_B       184 DFGFCAQVSKEVPKRKXLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLPPRVKD 263
gi 45751665  578 DFGFCAQVSKEVPKRKSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMVDGEPPYFNEPPLQAMRRIRDNLPPRLKE 657
gi 313661446 590 DFGFCAQVSKEVPRRKSLVGTPYWMAPEVISRMPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDNLPPRVKD 669
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|..
Feature 1                                                         #  
2F57_B       264 LHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYR 315
gi 45751665  658 SHKVSSVLRAFLDLMLVREPSQRASALELLQNPFLKLAGPPACIVPLMRHYR 709
gi 313661446 670 MHKVSSVLRGFLDLMLVREPSQRATAQELLRHPFLKLAGAPSCIVPLMRQHR 721

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap