Conserved Protein Domain Family
PLPDE_III_LS_D-TA_like

?
cd06820: PLPDE_III_LS_D-TA_like 
Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Low Specificity D-Threonine Aldolase-like
This subfamily is composed of uncharacterized bacterial proteins with similarity to low specificity D-threonine aldolase (D-TA), which is a fold type III PLP-dependent enzyme that catalyzes the interconversion between D-threonine/D-allo-threonine and glycine plus acetaldehyde. Both PLP and divalent cations (eg. Mn2+) are required for catalytic activity. Low specificity D-TAs show similarity to bacterial alanine racemase (AR), which contains an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. AR exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Based on its similarity to AR, it is possible that low specificity D-TAs also form dimers in solution. Experimental data show that the monomeric form of low specificity D-TAs exhibit full catalytic activity.
Statistics
?
PSSM-Id: 143494
View PSSM: cd06820
Aligned: 16 rows
Threshold Bit Score: 425.19
Threshold Setting Gi: 162431467
Created: 18-Jun-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:Based on the binding of the PLP cofactor and substrate analogs to other members of the superfamily.
  • Comment:The active site is composed of residues from both subunits of the dimer. There are two active sites in the functional dimer.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                         # #                   #                      # 
gi 21325381   40 IDTPAVLIDRERLTANISRMAAHAGAHEIALRPHVKTHKIIEIAQMQVDAGARGITCATIGEAEIFAGAGf--TDIFIAY 117
gi 119963284   8 VITPAVLIDVDVLDRNIERMAGNMRGRGLQLRPHVKTHKTLEIARKQLAAGALGITVATIGEAEVFAADGv--KDIFIAF 85
gi 52081132    6 LDTPALLIDKDVMLSNMKDMQNYANEQKVSLRPHTKTHKMPKLAKLQEEMGAVGIAVAKVGEAEVMARNGl--KDIFIAN 83
gi 149180769   7 LDTPTLLLDYQKLMKNINEIASFAKEHSLSYRPHIKTHKSVEIAKLQLQAGAIGITTATIPEAEAMAAGGi--NDILIAY 84
gi 87311059   13 ISTPAMVIDLPIVEKNLQKLHSYADQHGLHVRPHTKTHKSRYFARMQLKQGSSGLTVAKVGEAEVMALES---SDILIAY 89
gi 108757337   9 MTTPAALVDLDRVDANLKRVAMYTRQHGLRWRPHTKTHKTPEFAALQLAAGAQGVTVATVREAEVMATVC---DDILLAY 85
gi 169628346  13 LDTPFLAVDLAVMDRNIERLAGRLRGTGIRLRPHAKSHKCIEIARRQIDSGAIGLTVATVGEAEVFAEAGf--IDLFIAY 90
gi 119716914   8 PATPYLRVDVARLRANIERTTRWAAAGGVSLRPHAKTHKSPDIARLQLAAGAIGLTVATIGEAEVFVEHGa--EDVFVAY 85
gi 83816534    6 LSTPALLIEQSRLQENLAAMQATADANDVTLRPHVKTHKSVAIAEQQQQRGAEGLTVATVHEAETFVAAGf--DDVRVAY 83
gi 16264461    5 IETPAVLVDLDIARRNVLAFQAYADRHGIRVRPHIKTHKLPQMAELQLDAGAIGITCQKVTEAEAMVDGGariKDVLITY 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                              #      #                  
gi 21325381  118 PLyLTDHAVQRLNAIPGE---ISIGVDSV----EMAQATAGLRe----DIKALIEVDSGHRRSGVT----ATASELSQIr 182
gi 119963284  86 PLwVEAPHAERLRALTAKc-rLAVGVDSAesatAMGRQLGVDAg----SVEVLIEVDSGHHRSGVLp---DEVVDVAEAa 157
gi 52081132   84 EI-VGKSKLERIRKLSETi-dISFGIDSA----YQVREIEEVFegaskKAQVLVEIEVGEQRSGIIe--eDDFRTLLELi 155
gi 149180769  85 PI-ASPQKIKRLIALLEQdvkLKISVDNP----VQLTHLQNELehtpfTLEVWIKVNSGLNRCGVEp--gKDAVALAKNi 157
gi 87311059   90 PA-IDPDRRRRLAQLAQQh-tVRVAVDSA----YGVSALAAAAqeagsTIGILVDVNVGMNRTGVSt--pVEALQLAQQi 161
gi 108757337  86 PP-VGDDRLTRLMALPPHv-rLTVALDSGea-lEMLSRAARRAg---rTVGVLVELDLGMRRVGVQs--pEDAVALARAv 157
gi 169628346  91 PLwVTAQKARRLRQVASRa-aLRVAVDSA----AGAQQLAEHLgd--lPITVVIEVDSGHHRTGVAp---DQAGPVAAAa 160
gi 119716914  86 PLwLTENGARRLRDLADRa-dLAIGVDSA----EGARLAARLLeg--sGVVALVEVDSGQHRSGVDa---EDAGTVAAAa 155
gi 83816534   84 PV-VGRPKHERLRALRAAa-tLSFTVDTM----AGADQASAVYagadnPVEVLMEVDVGHGRCGVHwaddAAAVALAQHi 157
gi 16264461   85 NL-LGEQKLARLARLNERv-tVSVVADNA----TVVDGLAAFFadagkPLTVLVECNTGADRCGVGt--pSEAARLARRi 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                      #                                                           ##    
gi 21325381  183 e--aLGSRYAGVFTFPGHsygpg--------ngeqAAADELQALNNSVqr---------------laGGLTSGGSSPSAq 237
gi 119963284 158 a--aAGLSVQGVFTFPGHsykpg--------mptgAASNENEALGLAAtalts----------agfeVTTISGGSTPTAl 217
gi 52081132  156 k-tcQNVELKGIFSHDGHsykaks-----vahckeLYKESVERTLHFAriaee----------mdlkPKVVSIGSTPPFm 219
gi 149180769 158 m-gcTKLKLGGILTHAGHs---------------yAASSYAEIERIGNlegktvvesaeecekagipIPVRSVGSTPTYk 221
gi 87311059  162 aqseNSLRLDGIFFYPGHiw--------------rPADEQAEPLRQVDailaevit---lweshglsANIVSGGSTPTAy 224
gi 108757337 158 t-ssSGLEYRGITFYAGHlrmpq--------aelgDAMREQSVRLATYvdtla---------daglrPKTVSGGSTPTLw 219
gi 169628346 161 r--sAGLNVVGIFTFPGHgytpg--------hraeVAAQESHALDTAAaslra----------qgidPSVRSGGSTPTVg 220
gi 119716914 156 v--eAGLPVRGVFTFPGHsyspd--------alrsAADDEARVLRAATeslrs----------fglePDVVSGGSTPSLa 215
gi 83816534  158 a-slPGLQLAGILTHAGQaydgpsddetakgalrrAARHERDRMLSVAcalaead-----gvdvtpdDLEISVGSTPSMa 231
gi 16264461  157 a-eaPGLRFGGLMTYPPAdgaa----------rvqAFMSDAKRLIEAEgl----------------eVPCITSGGTPGMm 209
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                       ####                                              #              
gi 21325381  238 ft-------daIDEMRPGVYVFNDSQQITsGACTEKQVAMTVLSTVVSRNVsd----rRIILDAGSKILSTDkp----aw 302
gi 119963284 218 idg-----etvATELRPGVYVFGDAQQLElERCSWDDIALSVAATVVSRHEarggnvrRVVLDAGSKILGSDrp----dw 288
gi 52081132  220 fkfd---ipegVTEIRPGTYIFMDASQAN-VIGTYDRCAASVLTTVISKPTk-----eRVITDVGAKGITAQtrseglta 290
gi 149180769 222 isg----nvpgITEIRPGNAVFFDSIQAGlGVTSLENCALTVLASVVGVYSn------RIVLDTGSKTLCLDkgahgnet 291
gi 87311059  225 qsh----llpsQTEIRPGTNIFNDMNTVRaGYCELSECAVAIICTVVSTAVp-----gKCVIDAGTKTLTSDrnv--tqp 293
gi 108757337 220 rsh----evagLTEIRPGINIFNDRNAVSvGACPWEECAYSVLATVVSTTVp-----gQAVIDAGSKALAKEegf---td 287
gi 169628346 221 aad-----dtvLTEVRPGVYPFNDAQQLElDVCTLDDIALSAVTTVVHARGr------TAVVDAGSKILGADrp----gw 285
gi 119716914 216 hth-----tdeLTELRPGVYAFGDAQQWElGSAAPDDLALTCRATVVSHAGg------RLVLDAGSKALGADra----ay 280
gi 83816534  232 afenatrdgfrVTEIRPGNYVMHDAMQVAlGAAPLGDCALTVLTTVVSTQQkpd-gtaHAFVDAGKKVFTTDtg----yg 306
gi 16264461  210 qaa----eapiASEHRPGTYIYNDRSLVArGVASWEDCALTVLATVVSVPSe-----nRAIIDAGSKVLTSDll-----g 275
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 21325381  303 IDGNGFv-------LGNPEARISaLSEHHATIfwpdkvllPVIGEQLNIVPNHACNVINLVDEVYv---READGTFRTWK 372
gi 119963284 289 ATGYGRl-------PEYPEAKVTaLSEHHATVvwpdsselPPLGTRLRVIPNHVCLTMNLVDQVIv---VHGGAVAERWT 358
gi 52081132  291 TKGLGRi-------KEYEDVYIHgVFDEHAIIyheefnkkVSIGDKVRIIPNHICPVCNLHDKAYl---VDNGEVVDELN 360
gi 149180769 292 VRGFGHi-------IGHPEITVErLSEEHGVGtftg-egsLKLNDKVQIIPNHACTVANQFEEYAv---HEEGKVITTWK 360
gi 87311059  294 DSGHGHv-------LEYPRGKIVrLSEEHGEIdfadcdtlPKIGERLTVIPNHICPCVNLQNQVYl---QTPEKTIAMTD 363
gi 108757337 288 TGVYGAl-------LDRPDVLVRgLSEEHGLLdlsstdwrPRVGDRVRVVPNHACASVNLHDRLHl---LRQSTWAGTHA 357
gi 169628346 286 ATGFGRv-------IDEPDARIVaLSEHHATIefp--gaaPPPGTRLRVAPNHLCNAVNLVDSLV----IDAADGVRHWA 352
gi 119716914 281 ATGWGRl-------PAYPDARVVqLSEHHAVVdltg-aplPRLGSRVDVVPNHVCAAVNLADTLWadhgPDGSDALEPWP 352
gi 83816534  307 TDGHGIaladaaqmRPHPGLRVDhLSEEHGWLtmtg-dadLTVGDRLRIVPNHACVTVANQDTLHv---VDGPSVVDAWS 382
gi 16264461  276 LTGYGHv-------LGRDDIRIDqLSEEHGRLvsdg-qigLQVGELVRIVPNHACVVTNMVDAVHv---IEGGAPKGTWP 344

                 ....*
Feature 1             
gi 21325381  373 VVARG 377
gi 119963284 359 VAARG 363
gi 52081132  361 IEARG 365
gi 149180769 361 VERKK 365
gi 87311059  364 IDTRG 368
gi 108757337 358 ITARG 362
gi 169628346 353 VAARG 357
gi 119716914 353 VTARG 357
gi 83816534  383 VDARG 387
gi 16264461  345 VVARG 349

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap