3BTN,3BTN


Conserved Protein Domain Family
PLPDE_III_ODC_like_AZI

?
cd06831: PLPDE_III_ODC_like_AZI 
Click on image for an interactive view with Cn3D
Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Ornithine Decarboxylase-like Antizyme Inhibitor
Antizyme inhibitor (AZI) is homologous to the fold type III PLP-dependent enzyme ODC but does not retain any decarboxylase activity. Like ODC, AZI is presumed to exist as a homodimer. Antizyme is a regulatory protein that binds directly to the ODC monomer to block its active site, leading to its degradation by the 26S proteasome. AZI binds to Antizyme with a higher affinity than ODC, preventing the formation of the Antizyme-ODC complex. Thus, AZI blocks the ability of Antizyme to promote ODC degradation, which leads to increased ODC enzymatic activity and polyamine levels. AZI also prevents the degradation of other proteins regulated by Antizyme, such as cyclin D1.
Statistics
?
PSSM-Id: 143504
View PSSM: cd06831
Aligned: 5 rows
Threshold Bit Score: 718.553
Threshold Setting Gi: 29561807
Created: 13-Jun-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
dimer interface
Conserved site includes 12 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Comment:The antizyme inhibitor (AzI) crystallizes as a dimer, whose interface displays a smaller buried surface area compared to the ornithine decarboxylase dimer interface. The AzI dimer may not be physiological. Biochemical studies suggest that AzI exists as a monomer in solution.
  • Structure:3BTN; Interface between subunits in Mus musculus Antizyme Inhibitor homodimer; defined at 3.5A contacts.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                         ###            
3BTN_A        26 DNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQTVVAQIKPFYTVKCNSTPAVLEILAALGTGFACSSKNEMALVQELGVSP 105
3BTN_B        26 DNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQTVVAQIKPFYTVKCNSTPAVLEILAALGTGFACSSKNEMALVQELGVSP 105
gi 160420255  26 DHYIYDHTLMGKNAFFVADLGKIVKKHFKWKNIMGHIKPFYTVRCNSSPAVLEILAALGMGFACANKNEMSLVYDLGISM 105
gi 29561807   26 DNHIYEQNLAEKNAFVVADLGALMRQHVVWKTTMPLVRPFYPVSCNSSPVVIELLSALGVGFVCANKAETTLVLSHDVPP 105
gi 57242753   26 DNCIYEHTHTGKRAFYVGDLGKLVKKNIQWQNVMAPIKPFYTVRCNSTPGVLEILGTLGIGFACSSKSEMALVQGLGISP 105
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                     #                     #                                            
3BTN_A       106 ENIIFTSPCKQVSQIKYAAKVGVNIMTCDNEIELKKIARNHPNAKVLLHIATEDNIggEDGNMKFGTTLKNCRHLLECAK 185
3BTN_B       106 ENIIFTSPCKQVSQIKYAAKVGVNIMTCDNEIELKKIARNHPNAKVLLHIATEDNIggEDGNMKFGTTLKNCRHLLECAK 185
gi 160420255 106 ENVVYTNPCKQASQIKHAAKIGVNLMTCDSETELKKIARNHLNAKLLLHVATEGMSgeEEMSMTFGTTLKNCRHLLDCAK 185
gi 29561807  106 ENIILSGVCKQLSLIKHAAKTGINFLLCENEAELRKIARAHPEAKLLLQVSTEAQI--EEASVTIGCSLKGCRHLLELAK 183
gi 57242753  106 ENIIYTNPCKQASQIKYAAKAGINIMTCDSDIELKKIARNHPNAKLLLHIATEDITadEEMNMKFGTTLKNCRHLMECAK 185
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
3BTN_A       186 ELDVQIIGVKFHVSSACkEYQVYVHALSDARCVFDMAGEFGFTMNMLDIGGGFTGtEIQLEEVNHVISPLLDIYFPEGSG 265
3BTN_B       186 ELDVQIIGVKFHVSSACkEYQVYVHALSDARCVFDMAGEFGFTMNMLDIGGGFTGtEIQLEEVNHVISPLLDIYFPEGSG 265
gi 160420255 186 ELSVEVVGVKFHVSNSS-NQQTYNHALSDARCVFDMAEELGFKMNILDIGGIPEN-EAQLEELYQAVGPLLDVYFPEGSG 263
gi 29561807  184 ELNVSVAGVTFQVPASCkDPQAYTHALSDARCIFDMGKELGFDMNILDIGGGFSGsEFQLKQVHSVIRPLLEAYFPSESG 263
gi 57242753  186 EFGVQIVGVKFHVSGSCkELQTYIHAISDARCVFDMAEEFGFKMNMLDIGGGFTGsELQLEEVNHVIRPLLDVYFPKESG 265
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                              #                                          #              
3BTN_A       266 IQIISEPGSYYVSSAFTLAVNIIAKKVVENDKFSSGVEKn--gSDEPAFVYYMNDGVYGSFASKLSEDLNTIPEVHKKYk 343
3BTN_B       266 IQIISEPGSYYVSSAFTLAVNIIAKKVVENDKFSSGVEKn--gSDEPAFVYYMNDGVYGSFASKLSEDLNTIPEVHKKYk 343
gi 160420255 264 TRIIAEPGSFYVSSAFTLAVNVIAKETIEHDHHLSSAGKp--iSNKLAFVYCLNEGVYGSFARKLFEKLDTTPEVHKKYk 341
gi 29561807  264 VSIIAEPGNFFVFSCFTLAVNVIGKKAAYRNLHTSTHDKlt-sSDAPEFVYYMNDGVYGSFMGRLFGNIISTPSVHKMSl 342
gi 57242753  266 IQVIAEPGCYYVSSAFTLAVNVIAKKAVDCDKLLPSGVEqarnDDEPVFTYYINDGVYGSFASKLSEKLYTNPEVHKKYk 345
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
Feature 1                       # #                              #  #  #                      
3BTN_A       344 -eDEPLFTSSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYFMMSFSDWYEMQDAG 419
3BTN_B       344 -eDEPLFTSSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYFMMSFSDWYEMQDAG 419
gi 160420255 342 -dGEPLFTSSLLGASYDELDVIVDHCVLPELEVGDWIVFENMGCGSLNENSPFADFEKPSLYNFMSFNDWYGIQDTG 417
gi 29561807  343 tlDEPVFSSSLWGPSCDPLDQVVERCLLPELAVGDWLVFSNMGASGQEGPATFSDTDQPPVYYTISTDDWFEMQEAG 419
gi 57242753  346 -eDEPLFASSLWGPSCDELDQIVENCLLPELSVGDWLIFDNMGSGTLGEQSTFNDYQRPLIYYMMSFSDWDEMQDAG 421

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap