Conserved Protein Domain Family
PLPDE_III_PvsE_like

?
cd06843: PLPDE_III_PvsE_like 
Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme PvsE
This subfamily is composed of PvsE from Vibrio parahaemolyticus and similar proteins. PvsE is a vibrioferrin biosynthesis protein which is homologous to eukaryotic ornithine decarboxylase (ODC) and diaminopimelate decarboxylase (DapDC). ODC and DapDC are fold type III PLP-dependent enzymes that contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. It has been suggested that PvsE may be involved in the biosynthesis of the polycarboxylate siderophore vibrioferrin. It may catalyze the decarboxylation of serine to yield ethanolamine. PvsE may require homodimer formation and the presence of the PLP cofactor for activity.
Statistics
?
PSSM-Id: 143510
View PSSM: cd06843
Aligned: 16 rows
Threshold Bit Score: 467.913
Threshold Setting Gi: 158312520
Created: 1-Jul-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Feature 1:active site [active site]
Evidence:
  • Comment:Based on the structures of PLP and substrate bound to ornithine and diaminopimelate decarboxylases.
  • Comment:The active site is composed of residues from both subunits of the dimer. There are two active sites in the functional dimer.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                       # #                  #                     #     
gi 23307119   25 PLCAYLYDLnALEEHIKQLRHVLPKNVKLFYAAKANPSGPILNTLAPYVDGFEAASGGELTHLHQQQlDKPLIFGGPGKM 104
gi 38637786   31 PLSTYVYDLeALRRHATATARGLPPGFELFYAIKANSDLPILQTLAPLAHGFEISSGGELAWVREHFaDVPLIFSGPGKT 110
gi 114331720  21 SLCAYLYDLgALASHARNIKSSLPDRVNFFYAIKANSDLPILSALAEHVDGFEASSGGEIQWVRQNFpDVPLIFSGPGKL 100
gi 149374378  22 PLCAYVYDLpELRNRAQNIVGCLPPGCEMFYAAKANPALPVLSALASFVHGFEVASGGELDWVRRHFpDTSVIFGGPGKL 101
gi 21243907   24 PICAYVYDLaALDTHAAWMRAQLPAQCELFYAAKANAEPPILRTLAPHVDGFEAASGGELAWLHAQQpQAPLLFGGPGKL 103
gi 149180385  21 PVCAYVYDLkGLREHARRLKDSLPAFCSLYYAVKANPDNRILEALSGIVDGFDTASEGEILKVHKLS-ALPVIFAAPAKK 99
gi 15923113   17 PVCHYIYDLvGLEHHLQHITSSLPSNCQMYYAMKANSERTILDTISQYVEGFEVASQGEIAKGLAFKpANHIIFGGPGKT 96
gi 17548645   16 PVCAYLYDLdHLRERAARLSAMLPPGCELFYAIKANSDAPVLAALDGAVAGYEVASLGEVVRAREVGaQARIVFGGPGKT 95
gi 85714753   16 PVCAYLYDLaHLRRRADTLRRCLPAQCKLFYAIKANSDAPILRALLHRTDGFEVASLGEIQAVRGINdAVPVVFGGPGKT 95
gi 91791946   17 EVCAFIYDLdQLSAHIRTMTSRLPKQVDCYYAIKANSDSAILRALLPHVYGFEVASMGEIEKVRAISqNVPIAFGGPGKT 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                 #                                      
gi 23307119  105 pSELQQAIELdVDAIHVESlTELQRIGALTERlNRPASIFLRMNIdig------ditLSKLAMGGKPTPFGLDesELSNA 178
gi 38637786  111 dAELAGALELgVEALHVESlHELERLAWLARArGVTAPVLLRVNLaie------glqATTLMMGGKPTPFGIAgdQLPAC 184
gi 114331720 101 dTELELAILN-NVTVHIESrFELERLLHIARHyQQPAEILLRVNPhfe------dlrATSLMMGGKPTQFGISveHLSDC 173
gi 149374378 102 aSDLEKAIDQnVELIHVESlLELQRLCDIAGRrQANQDILLRINLela------dtpSTRLTMGGVPTPFGMEeaCIPDA 175
gi 21243907  104 dTELAQAAALpDCTVHVESlSELERLAEVASHaGRCVPVFLRMNIavp------gaqSTRLMMGGQPSPFGLDpcDLHAA 177
gi 149180385 100 dRELAYLADGsLRFMNVESeRDLYRLNRVGKEaGKALPVLIRINLqhn-------vsNSSHKMSGVPTQFGIEerKIPSI 172
gi 15923113   97 dEELRYAVSEgVQRIHVESmHELQRLNAILEDeDKTQHILLRVNLagp-------fpNATLHMAGRPTQFGISedEVDDV 169
gi 17548645   96 dDELQGALERgVELIHVESeLQLRRLDAIACRmGRRARVLLRVNPnplsadavgkraQGTLTMGGQPTQFGIEedAVPDL 175
gi 85714753   96 dAELEGALDQgVLLIHVESeHQLRRLDWIARRrNQRADILLRVNPasv-------pqQATLRMGGQATQFGIEeaQIPAL 168
gi 91791946   97 iTELTRALTLnVQLYHLESeLQLARLNQLAKEqNQLVRCLLRVNPyfd-------lpSATLQMAGQATQFGIDerELLAL 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                          #  #                                     ##                   
gi 23307119  179 LMLLRd-fPQVSLKGFHFHLMSHqLDVERHLALMQRYFQVVKAWQQEFEL-GELMINLGGGMGINYqnPEQHFPWMEFCD 256
gi 38637786  185 LAWLRa-hPEIRLRGFHFHLMSHqLDAAAHLRLLDAYLQQVRRWRAEYGLdTLDQVNVGGGIGVNYrePERQFDWAGFAE 263
gi 114331720 174 LKMVRdnsDCLYFQGFHFHLLSHqLDAAQHLRLLSAYIEQAVKWKEEFNL-VIDHINVGGGIGVNYkdIDQQFDWCHFSH 252
gi 149374378 176 LALLAr-qGRVRLRGFHFHLMSHqLDEKRHLTLIKHYLETVRTWEAQYGL-SLTEINVGGGIGINYtqPDQQFDWSGFCT 253
gi 21243907  178 MQRLQa-sPSLRLAGFHFHLMSHqRDATAQLHLVAAYLRTVQQWRQAYAL-GPLRVNAGGGFGVDYlaPEASFDWAGFCA 255
gi 149180385 173 LEKLSe-fPYIELNGFHFHAMSNnLNAEEHLIFVKRCLEKSLEWKKTFSL-DLGVVNIGGGIGVNYenPSESFDWTFFSE 250
gi 15923113  170 IEAALv-mPNIHLDGFHFHSISNnLDSNLHVDVVKLYFKKAKSWSEKHRF-PLKHINLGGGIGVNYadLTSQFEWDNFVE 247
gi 17548645  176 IRLARt-lPGVEVVGLHLHALSNnLDADSHLALMRHYLSLALRLRREHGL-TLDTLNVGGGIGVDYadPSHAFDWRRFCD 253
gi 85714753  169 IELALg-lPGVRLRGLHIHSISNnLDAQTHLALLEHYFDLTSTWQRRYQL-EFDWLNAGGGIGINYanPQASFDWEGFCA 246
gi 91791946  170 LPRLGd-yPNIQVEGLHFHCLSNnLDAVKHVTLVRHYLQTASTWAAQFGL-TWTTVNIGGGIGVTYq-GETEFDFPLYAE 246
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                          ####                                                          
gi 23307119  257 KLEFLIakeqvqdwTLRFECGRFITAACGYYVMEVLDIKQNLGENFVIARGGTHHFRTPAAQSHDHPFVILKSEQHhd-- 334
gi 38637786  264 GLPALSaqr--dglTVRLECGRYITAFCGYYAMEVIDVKHAFDRAFVVACGGTHHFRTPYAQGHSHPFRVLPVESWryp- 340
gi 114331720 253 GLNNLLigaaknipKIRFEMGRYVSAFCGVYVAEVIDIKTSGNGTYVVVKGGTHHFRTPYAQNHSHPFKVIPVSTWkkp- 331
gi 149374378 254 GLDELLqayvdrawRIRFECGRFITAPCGYYVGEVLDVKRCGEEWFAVCRGGTHHFRTPAAQAHNHPFDILPTNNTda-- 331
gi 21243907  256 GLPALLreha-tdlRLRLEPGRYVSASCGWYLMEVLDLKRSHGAWFAIARGGTHHFRTPAAQGHDHPFRVLRGERA---- 330
gi 149180385 251 GLHQMQeefeanqlELIMELGRYLTAQCGFYITEVIDLKQNYDEWFPLVRGGTHHLRLPAAWKMSHPFSVYPVTEWkeap 330
gi 15923113  248 NFKTLIveqemedvTLNFECGRFIVAHIGYYVTEVLDIKKVHGAWYAILRGGTQQFRLPVSWQHNHPFEIYRYKDNpys- 326
gi 17548645  254 GLGVLLaeag-agcRIVFECGRFIAADCGYYVTEVVDLKRNHGRWFAVLRGGTHHFRLPASWQHNHPFAILPNARWdyp- 331
gi 85714753  247 GLAALIaarq-prfQLVFECGRFLTADCGYYLADVTDLKHTHGKHFAILRGGSHHFRLPASWQHNHPFVVLPREAWpyp- 324
gi 91791946  247 QLTLLCrdy--pqlHLATECGRYISADCGVYLTEVTDIKLSHNEYFAVLRGGTHHFRLPSSWQHSHPFKIYPRETWhyp- 323
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
Feature 1                         ##                           #   #    #           
gi 23307119  335 -isHPIQHAQATFVGQLCTPKDVLARNQHVAHVDIGDYVVFTLAGAYAWNISHQNFLMHEPPIFHYF 400
gi 38637786  341 farPGVRDARVSVVGQLCTPKDVLAQDAPVDSVRAGDMVVFPYAGAYAWHISHHDFLRHPHPQHCYL 407
gi 114331720 332 ysrPGLRHGKVNIVGQLCTPKDLLAFDEMVGEIRVGDIVLFSHAGAYAWHISHHDFLRHAHPQHIYL 398
gi 149374378 332 -atPCVTDHSVTLVGQLCTPKDVFARQVHIASLGVGDLVVFRYAGAYAWNISHQAFLMHPHPEEYFI 397
gi 21243907  331 ---PVLRDTPVTLVGQLCTPKDVLARDQHVAALAPGDCLAFPLAGAYAWNISHQRFLMHPAPQMVFL 394
gi 149180385 331 lprPAVKGERITIAGELCTPNDLLVRKQYVDDLKVGDLVMFHLSGAYGWTISHHDFLSHPAPDFHYL 397
gi 15923113  327 fekVSISRQDTTLVGQLCTPKDVFAREVQIDAISTGDVIVFKYAGAYGWSISHHDFLSHPHPEFIYL 393
gi 17548645  332 ferPSVLAQAVTLCGELCTPKDVLARDVVVDRLRVGDRIVFQLAGAYGWHISHHDFLSHPHPERRFV 398
gi 85714753  325 fsrPAVHETPVTLCGELCTPKDTLACDVRVERLRAGDCIAFLLAGAYGWHISHHDFLSHPHPERVYL 391
gi 91791946  324 ftrPSVTDTAITLCGELCTPKDVLAKNVHVAQLKVADVIVFQKAGAYGWHISHHDFLSHPHPQRLYI 390

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap