Conserved Protein Domain Family
GT_GPT_euk

?
cd06855: GT_GPT_euk 
UDP-GlcNAc:dolichol-P GlcNAc-1-P transferase (GPT) catalyzes the transfer of GlcNAc-1-P from UDP-GlcNAc to dolichol-P to form GlcNAc-P-P-dolichol. The reaction is the first step in the assembly of dolichol-linked oligosaccharide intermediates and is essential for eukaryotic N-glycosylation. GPT activity has been identified in all eukaryotic cells examined to date. A series of six conserved motifs designated A through F, ranging in length from 5 to 13 amino acid residues, has been identified in this family. They have been determined to be important for stable expression, substrate binding, or catalytic activities.
Statistics
?
PSSM-Id: 133465
View PSSM: cd06855
Aligned: 29 rows
Threshold Bit Score: 184.372
Threshold Setting Gi: 41614857
Created: 28-Oct-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Mg++ bindingputative
Feature 1:Mg++ binding site [ion binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 156357179  23 IPRVKMLFAFAGLAGKDMNKKDnk---------------------dPIPEGLGAVGGALFLICMFlfiplpflsiwlekg 81
gi 123474469  48 IPRCMNAHLRRNLGGIDINKENdke------------------npkKIPESMGLQSSSAFLFALViiaafs--------- 100
gi 159479616  52 VPKVAAKTQARGICGKDLNKKGtpa------------------gdkPIPESAGLAPGCVFLLCVIcfellhyyd------ 107
gi 67472084   50 IPHMGNKCIEKGLFGLDINKGTq----------------------dKIPESMGLVCGIVFMFITMlfssl---------- 97
gi 193808907  68 LPRFIHFLHEKGLYGIDLNKISk----------------------dKVAQPIGLFPSILYLIFTLfyqllyyd------- 118
gi 75277248   99 IPVTARYVLRRNMFGFDINKRGtpq------------------gdiKVPESLGIVVGIVFLIVAIifqyfnft------- 153
gi 1170010    41 IPNVARTLLDRNIFGIDINKSTeeqrqkfaakrragqteekefqkqAIPESLGILVGAMYLSVVVvltvclrflga---- 116
gi 71032007   61 LTYFGTFFLIKLLKLRGLVSNNlnne-----------------tdeKVPEPGALVGCVLYILSMIfvqlllgd------- 116
gi 159109182  29 ILELAPKLEKAGLSGRDLNKAVs----------------------eKIPEDAGLGPSAMFLLTISlwslvm--------- 77
gi 116060999 110 LAYWMTMRLIPFVAAKTLSRNMrg--------------------etRVPESAGLACGGAYAMALTmqqlcqrlvrvafgq 169
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                    ##                                                  
gi 156357179  82 dfdfphhefvmFIAALLSICCMIFLGFADDVLDLKWRDKLILPTMASLPLLMVyfvnigvttiivpk------------- 148
gi 123474469 101 ------nekkdLYPALVSVVITTLLGFADDVLDIPWRVKIVIPIFTVLPLVLDyngstticlkgfllp------------ 162
gi 159479616 108 --igslawlvdYNAALATIGFMLFLGFSDDVLDIRWRVKLILPLFASLPLLVAysggtgialpkpl-------------- 171
gi 67472084   98 ------isipnYIISLLVILFNFIIGLIDDFLDIRWRYKLILSFCSSALIVIIypgscil-------------------- 151
gi 193808907 119 ----dhkilleYNAGLLSIIFITFLGFIDDILELKWRYKVVLPFFASLPLLLSysgntniripsfl-------------- 180
gi 75277248  154 ---edsnwlveYNAALASICFMILLGFVDDVLDVPWRVKLVLPSFATLPLLMAyaghttivipkpl-------------- 216
gi 1170010   117 agegldnpyasLPGPLMTITVMLLLGFVDDVLDVKWRHKIILTALGSLPLIMTydgslsvlmpcafgrfglstmnvmkew 196
gi 71032007  117 ----kcgkyfkVNPGLASIVLMTLLGLIDDVLLLNWFSKIAGPVLASLPLCLAycgtkigileyl--------------- 177
gi 159109182  78 ------prsstLLSAGFSIMASSFLGFVDDVVNLRWRYKLIVPSITLLPLVGAysgsglsl------------------- 132
gi 116060999 170 sagsaeswaveSNSALACVGYMVFLGFVDDVLDLPWRAKIVSPGFAALPLLLSyggattvlvpspvra------------ 237
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 156357179 149 ----------------------------------pvrfifgfdldlgiLYYVYMGMLAVFCTNAINILAGINGVEAGQSL 194
gi 123474469 163 ----------------------------------lrkifrfqcidigfLYQIFICLLTVFCTHSINIYAGINGLEAGQSF 208
gi 159479616 172 -----------------------------------aalglppylelgiLYKVYMVMLGIFCTNSINILAGVNGLEAGQTF 216
gi 67472084  152 -----------------------------------------fginlsiIYPFALICLSVFFTNSINMFAGVNGLESGQCI 190
gi 193808907 181 -----------------------------------nfifkeriidigfFYYLYIILLCVFCTNAINIYAGINGLEIGQSL 225
gi 75277248  217 -----------------------------------vayiglevlnlgrIYKLYMGLLAVFCTNSINIHAGLNGLEIGQTV 261
gi 1170010   197 rlglaapqgeptttfratapstwfsftvnhrsyvkvtesgaaliylgpVYLVYLSMLCIFCTNSINILAGVNGVEVGQSI 276
gi 71032007  178 ------------------------------------pkpinsgsyvklLSCFYIAILTVFCANSINIYAGINGLELGQSL 221
gi 159109182 133 ----------------------------------------gplrltssMTKLYCLLFAIFSQNAVNIYAGINGLEVGQSI 172
gi 116060999 238 ---------------------------------mfnfpadvrsidigaLYMVYMWLLVVFCSNSINIHAGLNGLEAGQSL 284
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 156357179 195 IIAMSIVLFNllelqgt-------------------ccwqnhlFSLYFMLPFIAVCSALLYYNWYPSSIFVGDTFCYFAG 255
gi 123474469 209 IVACFLLFHSlyywnv----------------------dkqaqAAATILIPFITSTYALLHFNWYPSRVFVGDTFTLTAG 266
gi 159479616 217 IVACAVLLHNllsvagwpgwgag--------gadaaaardghlFSAGLMLPLAATTFGLLVFNWYPSKVFVGDTFTYFAG 288
gi 67472084  191 IISAYSILHNiivllttss----------------skqyeaslLSLYLLIPFIFVTIVLFYYNKFPSKVFVGDSFTYFSG 254
gi 193808907 226 IIAFFISIHNlieiilnigtgqsk------gitegaqilkqhfLSIIFILPFVSINLVTFSFNFYPSKGFVGNTLTYFCG 299
gi 75277248  262 VIAAAILIHNvmqigasvd----------------peyhqahaFSIFLTQPLMATSLAMLAYNWYPSSVFVGDTYTVFAG 325
gi 1170010   277 VIAVASVVYNlfqmrldrqltpdfssldaaaadardmtsdhqlRALLLLGPFIGVSLALWRYNRYPARVFVGDSYTYFAG 356
gi 71032007  222 VMSLFILISNsldiykssgvky----------gefgmnlekkiYVLYLTMPFIAINIALICFNWYPAKLFVGNVYTLFSG 291
gi 159109182 173 VACTFLLPIVlyklyvaldttryae---hlapwqrllshpsllSSLVIIVCFLAVSHPVYLLNRYPSRVFVGDIYAYFAG 249
gi 116060999 285 IIAGAVLLLNvmaltsdpsd--------------epitagahlFSISLVLPFIATTLALLTHNWYPSKVFVGDTYTYFAG 350
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*...
Feature 1                                                                  
gi 156357179 256 MAFAVVGILGHFSKTMLLFFIPQVFNFVFSLPQLFKFVPCPRHRLPRLNPETGKLGMS 313
gi 123474469 267 TTIAAAGILGHFSEMTLLFMLPQIINFVLSLPQLFGIIPCPRHRLPKRNPQTGKLEGI 324
gi 159479616 289 MTIAVAGILGHFSETLLLFLLPQVFNFVYSLPQLFGIVHCPRHRLPVFDPATGLLRPK 346
gi 67472084  255 GVLGVASIIGGYDRLMFCLFFPEFINFFVSIPQLFGFIYCPRHRLPKLNKETHKLECV 312
gi 193808907 300 IFLAVLSIFGHFSKTLILFLIPQFLNFFLSLPQLLNFVPCPRHRLPVVNPKTNKLTYS 357
gi 75277248  326 MTMAVVGILGHFSETLLIFFLPQVLNFLLSLPQLAGIVKCPRHRLPRYDPATGLLTGT 383
gi 1170010   357 TVLAVSSITGVYSKTLLLFFAPQVFNFLISLPQLFSIVPCPRHRVPTWNPRTNLLSNS 414
gi 71032007  292 TFFSVVLIMSNMCEMAPFIFLPQLINFLLSIPQLLGFIPCPRHRVPRFNGRTKKLENS 349
gi 159109182 250 SVFASACILSDTLIAGPLLFLPQILNFVLSVPQLFGIVPCPRHRLPRFSQDHGTLTGV 307
gi 116060999 351 MTLGVAGTLGHFSETLLLFFFPQVLNFLYSTPQLFKFVHCPRHRLPIFDPKTGLLHPS 408

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap