Conserved Protein Domain Family
PX_Vps5p

?
cd06861: PX_Vps5p 
The phosphoinositide binding Phox Homology domain of yeast sorting nexin Vps5p
The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Sorting nexins (SNXs) make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. Vsp5p is the yeast counterpart of human SNX1 and is part of the retromer complex, which functions in the endosome-to-Golgi retrieval of vacuolar protein sorting receptor Vps10p, the Golgi-resident membrane protein A-ALP, and endopeptidase Kex2. The PX domain of Vps5p binds phosphatidylinositol-3-phosphate (PI3P). Similar to SNX1, Vps5p contains a Bin/Amphiphysin/Rvs (BAR) domain, which detects membrane curvature, C-terminal to the PX domain. Both domains have been shown to determine the specific membrane-targeting of SNX1.
Statistics
?
PSSM-Id: 132771
View PSSM: cd06861
Aligned: 10 rows
Threshold Bit Score: 190.641
Threshold Setting Gi: 169849281
Created: 10-Jul-2008
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
phosphoinosit..
Feature 1:phosphoinositide binding site [chemical binding site]
Evidence:
  • Comment:A majority of PX domain containing proteins binds phosphatidylinositol-3-phosphate (PI3P) at this site. In some cases, other phosphoinositides, such as PI4P or PI(3,4)P2, are the preferred substrates.
  • Comment:based on the structures of phosphatidylinositol-3-phosphate bound to other members of this superfamily
  • Comment:Two basic residues are key in binding with phosphoinositides: one forms hydrogen bonds with the 3-phosphate of PI(3)P and another forms hydrogen bonds with the 4-and 5-hydroxyl groups of PI(3)P.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                       ###                       ##      
gi 2499128    281 FKVEVKDPVKVGELTSIHVEYTVISESsll-------elkYAQVSRRYRDFRWLYRQLQNNHWGKVIPPPPEKQS-VGSF 352
gi 58265922   519 FQISVSDPTRVGDAVRGYTVYTIRTRTssph-----yqqsTFSCLRRFSDFLWLFEQLSHNNPGVIVPPMPDKHS-WGRF 592
gi 169849281  290 FVITVDDPQKVGDPLRPYIMYTVHTRTtspl-----fhksAFSVLRRYSDFVWLYEALCYNNPGVVVPPVPEKSS-FGRF 363
gi 19075429   202 FYIQVHDPHTVKEITKSHTVYSVSTRLeehnq----psvsNVTVQRRYNDFAFLYQLLSNNHPGCIIPPIPEKQV-VGRF 276
gi 50545211   252 FEISVGDPIKVGDITSSHTVYTVSTKTnhpn-----fktdAGSVTRRYSDFRWLFHALENKHPGIVVPPPPDKQA-VGRF 325
gi 71022409   681 FSIKVGDPQRIGDPISAHTVYTVRTTTdcph-----frssHFSSLRRYRDFRWLHAALVQNNPGIIVPPVPEKVS-IGRF 754
gi 68480854   272 LEITVGDPTKVGDLTTAHVVYTIKTVNknldsk-ffpaveSVQVSRRYRDFRWIYHQLQNNHPGRIIPPPPSKQTfIGRF 350
gi 156849039  275 FIINVTDPIKVGDMTSAHVEYLITSKSpll-------epnSSSVYRRYSDVRWLYRQLQSNHWGRVVPPPPEKQI-IGRF 346
gi 159125520  125 FEITVGDPHKVGDLTSSHIVYQVRTKTtska-----yrqpEFTVSRRYRDFLWLYNSMHNNNPGVVVPPPPEKQA-VGRF 198
gi 213409243  150 YEITIHDPHKVGELTSAHTVYCVTSTVtypnaqspteskeELQVERRYRDFLLLYQLLGATHPGTIIPPAPEKQV-VGRF 228
                          90       100       110
                  ....*....|....*....|....*....|....*...
Feature 1                #                              
gi 2499128    353 KENFIENRRFQMESMLKKICQDPVLQKDKDFLLFLTSD 390
gi 58265922   593 EDQFVETRRLALEKCLKKITSNPILQLDPDLRLFLESD 630
gi 169849281  364 EDQFVRQRRLGLEKCIQKMANHPVLAKDPDLRLFLESD 401
gi 19075429   277 DDEFIEQRRAALEVMLRKISAHPVLRDDYSFKLFLEAE 314
gi 50545211   326 NEDFVEARRAALETMLQKVARHHLLQDDPDLQLFLQSE 363
gi 71022409   755 AAELVEARRVGLETCINKIANHPLLQQDDDFRLFLESE 792
gi 68480854   351 NENFIENRRLSLEKMLSKINHHPLLCNDPDFVMFLTSQ 388
gi 156849039  347 QVNFIEYRRSQFELMLRDIANDPVLQKDDAFISFLTSV 384
gi 159125520  199 DTNFVESRRAALERMLNKIAAHPILQHDADLKIFLESE 236
gi 213409243  229 DDEFVELRRASLEKMIRKIAQHPRLCQDDAFRYFLSAS 266

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap