2ETT


Conserved Protein Domain Family
PX_SNX22

?
cd06880: PX_SNX22 
Click on image for an interactive view with Cn3D
The phosphoinositide binding Phox Homology domain of Sorting Nexin 22
The PX domain is a phosphoinositide (PI) binding module present in many proteins with diverse functions. Sorting nexins (SNXs) make up the largest group among PX domain containing proteins. They are involved in regulating membrane traffic and protein sorting in the endosomal system. The PX domain of SNXs binds PIs and targets the protein to PI-enriched membranes. SNXs differ from each other in PI-binding specificity and affinity, and the presence of other protein-protein interaction domains, which help determine subcellular localization and specific function in the endocytic pathway. SNX22 may be involved in recruiting other proteins to the membrane via protein-protein and protein-ligand interaction. The biological function of SNX22 is not yet known.
Statistics
?
PSSM-Id: 132790
View PSSM: cd06880
Aligned: 15 rows
Threshold Bit Score: 155.895
Threshold Setting Gi: 156398285
Created: 10-Jul-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
phosphoinosit..
Conserved site includes 6 residues -Click on image for an interactive view with Cn3D
Feature 1:phosphoinositide binding site [chemical binding site]
Evidence:
  • Comment:A majority of PX domain containing proteins binds phosphatidylinositol-3-phosphate (PI3P) at this site. In some cases, other phosphoinositides, such as PI4P or PI(3,4)P2, are the preferred substrates.
  • Comment:based on the structures of phosphatidylinositol-3-phosphate bound to other members of this superfamily
  • Comment:Two basic residues are key in binding with phosphoinositides: one forms hydrogen bonds with the 3-phosphate of PI(3)P and another forms hydrogen bonds with the 4-and 5-hydroxyl groups of PI(3)P.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                           ###                       ## 
2ETT_A        10 LEVHIPSVGPEAEGprq--------speKSHMVFRVEVLCSGR--RHTVPRRYSEFHALHKRIKKLYK---VPDFPSKRL 76
gi 148225174   2 IEVCVPSVGHELYKs------------dKTHTVFRMDVLFNGR--RHTLDRRYSEFHALHKLLKKTCK---VPDFPPKRV 64
gi 76253892    4 IEVSIPSFRSEGSTv------------eKGYTVFKIEVLMCGR--QHTVEKRYSEFHALHRMLKKIIK---PPEIPSKHV 66
gi 118095472   2 IVVSIPAAEPEVTArs----------peKAHTVFLVEVLCNGR--RHTVAKRYSEFQALHKRIKKSCK---VPDFPPRRV 66
gi 113679334  11 IEVFIPSLMREVDEt------------gKLRKLFRVEILFNGR--KHFVLRRHGEFQTLHRKVKKILR---VPDFPSKRN 73
gi 156545535   2 YQVFISGYRLANVSh------------gKPYYVYTVEMVDSNNgaRYLIEKRYSEFNTLHRMLKKDCH---TAPFPPKRV 66
gi 219506382 108 LCSPVPWFTCAHLShdlpvptcpmvylcPPVQVFVIEVCAAGR--RHTLEKRYSELHTLHRELKKSYL---TPEFPPKRV 182
gi 193650285   2 TEITIPKYGLVHDV--------------KPHYVYTIKVLSAGI--QECVEKRYSAFHAFHRELRKSIS---TPPFPSKRI 62
gi 215498927   2 IRVFVPNYRQVYAPn------------gRQYVVYCVEVTVSGV--CHKLERRYRTFHALHKKVKRMLGnraPSGFPPKRL 67
gi 212512658   2 NEIKIENYRIVENGs------------kKPFCLYTIEIYVNGT--RYVVEKRYSQFHALHEELRKLHP---TPNFPPKKV 64
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
Feature 1                  #                                     
2ETT_A        77 PNWRTRGLEQRRQGLEAYIQGILYLNQeVPKELLEFLRLRHFPTDPKA 124
gi 148225174  65 PNWMQKVQEHRRQGLEAYIQGVLWYNTdVPKELLDFLKVRHFHKEIKN 112
gi 76253892   67 RNWVPKVLEQRRQGLELYLQTIIMENEvLPKIFLDFLNIRHFPSLPKT 114
gi 118095472  67 PNWVPKVLEQRRQGLELYIQGVLCHNEeLPQDVLDFLKVRRCQQELKD 114
gi 113679334  74 QHLRTKPLEQRRQELEDYIQVILYQNDvVPQELLDFLQVKHFHPTSKN 121
gi 156545535  67 RNSNPKVLEQRRAALEIYMQKMLRLAS-TKQQVLNFLGIDGANSEIYH 113
gi 219506382 183 RNWNPKVLEQRRRGLETYLQGLIHQDI-LPKILLDFLEINMATQLGYE 229
gi 193650285  63 RCSQPKVLEQRRAGLERYLQTVFKIEG-GYKQVMEFLGLEYQPSHKID 109
gi 215498927  68 RSLNPKLLEQRRIGLEHYLQNLVRVPT-LSNQLLSFLEVPTPMSPAAS 114
gi 212512658  65 RSLQQRVLEKRKQALEKYLLTMLKFQQ-SRSHVLSFLGINKPENNHSS 111

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap